PDCD1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PDCD1
Ідентифікатори
Символи PDCD1systemic lupus erythematosus susceptibility 2protein PD-1programmed cell death 1 proteinProgrammed Cell Death 1 Receptorprogrammed cell death protein 1
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

PDCD1 (англ. Programmed cell death 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 288 амінокислот, а молекулярна маса — 31 647[2].


Відкриття[ред. | ред. код]

Під час скринінгу генів, залучених до апоптозу, Ясумаса Ісіда, Хондзьо Тасуку і його колеги з Університету Кіото в 1992 році виявили і назвали PD-1.[3][4] У 1999 році одна і та ж група продемонструвала, що миші з нокаутованим PD-1, були схильні до автоімунного захворювання, і тому прийшли до висновку, що PD-1 є негативним регулятором імунних відповідей.[4]

Послідовність амінокислот
1020304050
MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNA
TFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQL
PNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAE
VPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARGTI
GARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYAT
IVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL

Задіяний у таких біологічних процесах як апоптоз, імунітет, поліморфізм. Локалізований у мембрані.

Література[ред. | ред. код]

  • Shinohara T., Taniwaki M., Ishida Y., Kawaich M., Honjo T. (1994). Structure and chromosomal localization of the human PD-1 gene (PDCD1).. Genomics 23: 704 — 706.  PubMed DOI:10.1006/geno.1994.1562
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Fife B.T., Pauken K.E. (2011). The role of the PD-1 pathway in autoimmunity and peripheral tolerance.. Ann. N. Y. Acad. Sci. 1217: 45 — 59.  PubMed DOI:10.1111/j.1749-6632.2010.05919.x

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:8760 (англ.). Процитовано 28 серпня 2017. 
  2. UniProt, Q15116 (англ.). Процитовано 28 серпня 2017. 
  3. Induced expression of PD-1, a novel member of the immunoglobulin gene superfamily, upon programmed cell death. The EMBO Journal 11 (11): 3887–95. November 1992. PMC 556898. PMID 1396582. doi:10.1002/j.1460-2075.1992.tb05481.x.  Проігноровано невідомий параметр |vauthors= (довідка)
  4. а б The PD1:PD-L1/2 Pathway from Discovery to Clinical Implementation. Frontiers in Immunology 7: 550. 2016. PMC 5149523. PMID 28018338. doi:10.3389/fimmu.2016.00550.  Проігноровано невідомий параметр |vauthors= (довідка)

Див. також[ред. | ред. код]