PDE5A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PDE5A
Protein PDE5A PDB 3BJC.png
Ідентифікатори
Символи phosphodiesterase isozyme 5CGB-PDEcGMP-specific 3',5'-cyclic phosphodiesterasecGMP-specific phosphodiesterase PDE5A2cGMP-binding cGMP-specific phosphodiesterasePDE5AcGMP-specific phosphodiesterase type 5Aphosphodiesterase 5AcGMP-specificcGMP-binding cGMP-specific 3',5'-cyclic nucleotide phosphodiesterase
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE PDE5A 206757 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

PDE5A (англ. Phosphodiesterase 5A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 875 амінокислот, а молекулярна маса — 99 985[2].

Послідовність амінокислот
1020304050
MERAGPSFGQQRQQQQPQQQKQQQRDQDSVEAWLDDHWDFTFSYFVRKAT
REMVNAWFAERVHTIPVCKEGIRGHTESCSCPLQQSPRADNSAPGTPTRK
ISASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQMPLTPPRFDHDEGDQCS
RLLELVKDISSHLDVTALCHKIFLHIHGLISADRYSLFLVCEDSSNDKFL
ISRLFDVAEGSTLEEVSNNCIRLEWNKGIVGHVAALGEPLNIKDAYEDPR
FNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDE
KDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVI
LKKIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTR
EHDANKINYMYAQYVKNTMEPLNIPDVSKDKRFPWTTENTGNVNQQCIRS
LLCTPIKNGKKNKVIGVCQLVNKMEENTGKVKPFNRNDEQFLEAFVIFCG
LGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETRELQSLAAAVVPS
AQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWIL
SVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEILALLIAA
LSHDLDHRGVNNSYIQRSEHPLAQLYCHSIMEHHHFDQCLMILNSPGNQI
LSGLSIEEYKTTLKIIKQAILATDLALYIKRRGEFFELIRKNQFNLEDPH
QKELFLAMLMTACDLSAITKPWPIQQRIAELVATEFFDQGDRERKELNIE
PTDLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCFPLLDGCRKNR
QKWQALAEQQEKMLINGESGQAKRN

Кодований геном білок за функціями належить до гідролаз, фосфопротеїнів. Задіяний у таких біологічних процесах як поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з нуклеотидами, іонами металів.

Література[ред. | ред. код]

  • Stacey P., Rulten S., Dapling A., Phillips S.C. (1998). Molecular cloning and expression of human cGMP-binding cGMP-specific phosphodiesterase.. Biochem. Biophys. Res. Commun. 247: 249 — 254.  PubMed DOI:10.1006/bbrc.1998.8769
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Rybalkin S.D., Rybalkina I.G., Feil R., Hofmann F., Beavo J.A. (2002). Regulation of cGMP-specific phosphodiesterase (PDE5) phosphorylation in smooth muscle cells.. J. Biol. Chem. 277: 3310 — 3317.  PubMed DOI:10.1074/jbc.M106562200
  • Zhou L., Thompson W.J., Potter D.E. (1999). Multiple cyclic nucleotide phosphodiesterases in human trabecular meshwork cells.. Invest. Ophthalmol. Vis. Sci. 40: 1745 — 1752.  PubMed

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:8784 (англ.). Процитовано 30 серпня 2017. 
  2. UniProt, O76074 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]