PFN2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PFN2
Protein PFN2 PDB 1d1j.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PFN2, D3S1319E, PFL, profilin 2
Зовнішні ІД OMIM: 176590 MGI: 97550 HomoloGene: 1974 GeneCards: PFN2
Шаблон експресії
PBB GE PFN2 204992 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_053024
NM_002628
NM_019410
RefSeq (білок)
NP_002619
NP_444252
NP_062283
Локус (UCSC) Хр. 3: 149.96 – 150.05 Mb Хр. 3: 57.84 – 57.85 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PFN2 (англ. Profilin 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 140 амінокислот, а молекулярна маса — 15 046[4].

Послідовність амінокислот
1020304050
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDM
IVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYN
VAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF

Задіяний у таких біологічних процесах як ацетиляція, альтернативний сплайсинг. Білок має сайт для зв'язування з молекулою актину. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Honore B., Madsen P.S., Andersen A.H., Leffers H. (1993). Cloning and expression of a novel human profilin variant, profilin II.. FEBS Lett. 330: 151 — 155.  PubMed DOI:10.1016/0014-5793(93)80262-S
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Gieselmann R., Kwiatkowski D.J., Janmey P.A., Witke W. (1995). Distinct biochemical characteristics of the two human profilin isoforms.. Eur. J. Biochem. 229: 621 — 628.  PubMed DOI:10.1111/j.1432-1033.1995.tb20506.x
  • Nodelman I.M., Bowman G.D., Lindberg U., Schutt C.E. (1999). X-ray structure determination of human profilin II: a comparative structural analysis of human profilins.. J. Mol. Biol. 294: 1271 — 1285.  PubMed DOI:10.1006/jmbi.1999.3318

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:8882 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, P35080 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]