PIAS1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PIAS1
Protein PIAS1 PDB 1v66.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PIAS1, DDXBP1, GBP, GU/RH-II, ZMIZ3, protein inhibitor of activated STAT 1
Зовнішні ІД OMIM: 603566 MGI: 1913125 HomoloGene: 22953 GeneCards: PIAS1
Шаблон експресії
PBB GE PIAS1 217864 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_016166
NM_001320687
NM_019663
RefSeq (білок)
NP_001307616
NP_057250
NP_062637
Локус (UCSC) Хр. 15: 68.05 – 68.2 Mb Хр. 9: 62.88 – 62.99 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PIAS1 (англ. Protein inhibitor of activated STAT 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 651 амінокислот, а молекулярна маса — 71 836[4].

Послідовність амінокислот
1020304050
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCS
PAVQMKIKELYRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYD
GHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFYDLLDEL
IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQL
RFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNGVEPKRPSRPI
NITSLVRLSTTVPNTIVVSWTAEIGRNYSMAVYLVKQLSSTVLLQRLRAK
GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALT
CSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCT
DCDEIQFKEDGTWAPMRSKKEVQEVSASYNGVDGCLSSTLEHQVASHHQS
SNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPH
QASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDLQGLDFFPFLS
GDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTS
LPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISL
D

Кодований геном білок за функціями належить до лігаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, убіквітинування білків, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Wang P., Yu P., Gao P., Shi T., Ma D. (2009). Discovery of novel human transcript variants by analysis of intronic single-block EST with polyadenylation site.. BMC Genomics 10: 518 — 518.  PubMed DOI:10.1186/1471-2164-10-518
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Valdez B.C., Henning D., Perlaky L., Busch R.K., Busch H. (1997). Cloning and characterization of Gu/RH-II binding protein.. Biochem. Biophys. Res. Commun. 234: 335 — 340.  PubMed DOI:10.1006/bbrc.1997.6642
  • Kahyo T., Nishida T., Yasuda H. (2001). Involvement of PIAS1 in the sumoylation of tumor suppressor p53.. Mol. Cell 8: 713 — 718.  PubMed DOI:10.1016/S1097-2765(01)00349-5
  • Miyauchi Y., Yogosawa S., Honda R., Nishida T., Yasuda H. (2002). Sumoylation of Mdm2 by protein inhibitor of activated STAT (PIAS) and RanBP2 enzymes.. J. Biol. Chem. 277: 50131 — 50136.  PubMed DOI:10.1074/jbc.M208319200
  • Schmidt D., Mueller S. (2002). Members of the PIAS family act as SUMO ligases for c-Jun and p53 and repress p53 activity.. Proc. Natl. Acad. Sci. U.S.A. 99: 2872 — 2877.  PubMed DOI:10.1073/pnas.052559499

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:2752 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, O75925 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]