PIM1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PIM1
Protein PIM1 PDB 1xqz.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PIM1, PIM, Pim-1 proto-oncogene, serine/threonine kinase
Зовнішні ІД OMIM: 164960 MGI: 97584 HomoloGene: 11214 GeneCards: PIM1
Реагує на сполуку
ruboxistaurin[1]
Шаблон експресії
PBB GE PIM1 209193 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002648
NM_001243186
NM_008842
NM_001364913
RefSeq (білок)
NP_001230115
NP_002639
NP_032868
NP_001351842
Локус (UCSC) Хр. 6: 37.17 – 37.18 Mb Хр. 17: 29.49 – 29.5 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PIM1 (англ. Pim-1 proto-oncogene, serine/threonine kinase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 404 амінокислот, а молекулярна маса — 45 412[5].

Послідовність амінокислот
1020304050
MPHEPHEPLTPPFSALPDPAGAPSRRQSRQRPQLSSDSPSAFRASRSHSR
NATRSHSHSHSPRHSLRHSPGSGSCGSSSGHRPCADILEVGMLLSKINSL
AHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVS
DNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDW
FERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCH
NCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSP
PEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRV
SSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSP
GPSK

Кодований геном білок за функціями належить до трансфераз, кіназ, серин/треонінових протеїнкіназ, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, клітинний цикл. Білок має сайт для зв'язування з АТФ, нуклеотидами, іонами металів, іоном магнію. Локалізований у клітинній мембрані, цитоплазмі, ядрі, мембрані.

Література[ред. | ред. код]

  • Reeves R., Spies G.A., Kiefer M., Barr P.J., Power M. (1990). Primary structure of the putative human oncogene, pim-1.. Gene 90: 303 — 307.  PubMed DOI:10.1016/0378-1119(90)90195-W
  • Zakut-Houri R., Hazum S., Givol D., Telerman A. (1987). The cDNA sequence and gene analysis of the human pim oncogene.. Gene 54: 105 — 111.  PubMed DOI:10.1016/0378-1119(87)90352-0
  • Meeker T.C., Nagarajan L., Ar-Rushdi A., Croce C.M. (1987). Cloning and characterization of the human PIM-1 gene: a putative oncogene related to the protein kinases.. J. Cell. Biochem. 35: 105 — 112.  PubMed DOI:10.1002/jcb.240350204
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Telerman A., Amson R., Zakut-Houri R., Givol D. (1988). Identification of the human pim-1 gene product as a 33-kilodalton cytoplasmic protein with tyrosine kinase activity.. Mol. Cell. Biol. 8: 1498 — 1503.  PubMed DOI:10.1128/MCB.8.4.1498
  • Koike N., Maita H., Taira T., Ariga H., Iguchi-Ariga S.M.M. (2000). Identification of heterochromatin protein 1 (HP1) as a phosphorylation target by Pim-1 kinase and the effect of phosphorylation on the transcriptional repression function of HP1.. FEBS Lett. 467: 17 — 21.  PubMed DOI:10.1016/S0014-5793(00)01105-4

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]