PKP1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PKP1
Protein PKP1 PDB 1xm9.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PKP1, B6P, plakophilin 1
Зовнішні ІД OMIM: 601975 MGI: 1328359 HomoloGene: 253 GeneCards: PKP1
Пов'язані генетичні захворювання
panic disorder, Skin fragility syndrome[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001005337
NM_000299
NM_019645
NM_001313701
RefSeq (білок)
NP_000290
NP_001005337
NP_001300630
NP_062619
Локус (UCSC) Хр. 1: 201.28 – 201.33 Mb Хр. 1: 135.87 – 135.92 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PKP1 (англ. Plakophilin 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 747 амінокислот, а молекулярна маса — 82 861[5].

Послідовність амінокислот
1020304050
MNHSPLKTALAYECFQDQDNSTLALPSDQKMKTGTSGRQRVQEQVMMTVK
RQKSKSSQSSTLSHSNRGSMYDGLADNYNYGTTSRSSYYSKFQAGNGSWG
YPIYNGTLKREPDNRRFSSYSQMENWSRHYPRGSCNTTGAGSDICFMQKI
KASRSEPDLYCDPRGTLRKGTLGSKGQKTTQNRYSFYSTCSGQKAIKKCP
VRPPSCASKQDPVYIPPISCNKDLSFGHSRASSKICSEDIECSGLTIPKA
VQYLSSQDEKYQAIGAYYIQHTCFQDESAKQQVYQLGGICKLVDLLRSPN
QNVQQAAAGALRNLVFRSTTNKLETRRQNGIREAVSLLRRTGNAEIQKQL
TGLLWNLSSTDELKEELIADALPVLADRVIIPFSGWCDGNSNMSREVVDP
EVFFNATGCLRKRLGMRELLALVPQRATSSRVNLSSADAGRQTMRNYSGL
IDSLMAYVQNCVAASRCDDKSVENCMCVLHNLSYRLDAEVPTRYRQLEYN
ARNAYTEKSSTGCFSNKSDKMMNNNYDCPLPEEETNPKGSGWLYHSDAIR
TYLNLMGKSKKDATLEACAGALQNLTASKGLMSSGMSQLIGLKEKGLPQI
ARLLQSGNSDVVRSGASLLSNMSRHPLLHRVMGNQVFPEVTRLLTSHTGN
TSNSEDILSSACYTVRNLMASQPQLAKQYFSSSMLNNIINLCRSSASPKA
AEAARLLLSDMWSSKELQGVLRQQGFDRNMLGTLAGANSLRNFTSRF

Кодований геном білок за функціями належить до білків розвитку, фосфопротеїнів. Задіяний у такому біологічному процесі як клітинна адгезія. Локалізований у ядрі, клітинних контактах.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Choi H.-J., Weis W.I. (2005). Structure of the armadillo repeat domain of plakophilin 1.. J. Mol. Biol. 346: 367 — 376.  PubMed DOI:10.1016/j.jmb.2004.11.048
  • Hatzfeld M., Kristjansson G.I., Plessmann U., Weber K. (1994). Band 6 protein, a major constituent of desmosomes from stratified epithelia, is a novel member of the armadillo multigene family.. J. Cell Sci. 107: 2259 — 2270.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]