PKP3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PKP3
Ідентифікатори
Символи PKP3, plakophilin 3
Зовнішні ІД OMIM: 605561 MGI: 1891830 HomoloGene: 5200 GeneCards: PKP3
Шаблон експресії
PBB GE PKP3 209872 s at fs.png

PBB GE PKP3 209873 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_007183
NM_001303029
NM_001162924
NM_019762
RefSeq (білок)
NP_001289958
NP_009114
NP_001156396
NP_062736
Локус (UCSC) Хр. 11: 0.39 – 0.4 Mb Хр. 7: 141.08 – 141.09 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PKP3 (англ. Plakophilin 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 797 амінокислот, а молекулярна маса — 87 082[4].

Послідовність амінокислот
1020304050
MQDGNFLLSALQPEAGVCSLALPSDLQLDRRGAEGPEAERLRAARVQEQV
RARLLQLGQQPRHNGAAEPEPEAETARGTSRGQYHTLQAGFSSRSQGLSG
DKTSGFRPIAKPAYSPASWSSRSAVDLSCSRRLSSAHNGGSAFGAAGYGG
AQPTPPMPTRPVSFHERGGVGSRADYDTLSLRSLRLGPGGLDDRYSLVSE
QLEPAATSTYRAFAYERQASSSSSRAGGLDWPEATEVSPSRTIRAPAVRT
LQRFQSSHRSRGVGGAVPGAVLEPVARAPSVRSLSLSLADSGHLPDVHGF
NSYGSHRTLQRLSSGFDDIDLPSAVKYLMASDPNLQVLGAAYIQHKCYSD
AAAKKQARSLQAVPRLVKLFNHANQEVQRHATGAMRNLIYDNADNKLALV
EENGIFELLRTLREQDDELRKNVTGILWNLSSSDHLKDRLARDTLEQLTD
LVLSPLSGAGGPPLIQQNASEAEIFYNATGFLRNLSSASQATRQKMRECH
GLVDALVTSINHALDAGKCEDKSVENAVCVLRNLSYRLYDEMPPSALQRL
EGRGRRDLAGAPPGEVVGCFTPQSRRLRELPLAADALTFAEVSKDPKGLE
WLWSPQIVGLYNRLLQRCELNRHTTEAAAGALQNITAGDRRWAGVLSRLA
LEQERILNPLLDRVRTADHHQLRSLTGLIRNLSRNARNKDEMSTKVVSHL
IEKLPGSVGEKSPPAEVLVNIIAVLNNLVVASPIAARDLLYFDGLRKLIF
IKKKRDSPDSEKSSRAASSLLANLWQYNKLHRDFRAKGYRKEDFLGP

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як клітинна адгезія. Локалізований у ядрі, клітинних контактах.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240
  • Bonne S., van Hengel J., Nollet F., Kools P., van Roy F. (1999). Plakophilin-3, a novel armadillo-like protein present in nuclei and desmosomes of epithelial cells.. J. Cell Sci. 112: 2265 — 2276.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:9025 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q9Y446 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]