PLCG2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PLCG2
Protein PLCG2 PDB 2K2J.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PLCG2, APLAID, FCAS3, PLC-IV, PLC-gamma-2, phospholipase C gamma 2
Зовнішні ІД OMIM: 600220 MGI: 97616 HomoloGene: 55671 GeneCards: PLCG2
Пов'язані генетичні захворювання
рак молочної залози, familial cold autoinflammatory syndrome 3[1]
Шаблон експресії
PBB GE PLCG2 204613 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002661
NM_172285
RefSeq (білок)
NP_002652
NP_758489
Локус (UCSC) Хр. 16: 81.74 – 81.96 Mb Хр. 8: 117.5 – 117.64 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PLCG2 (англ. Phospholipase C gamma 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 1 265 амінокислот, а молекулярна маса — 147 870[5].

Послідовність амінокислот
1020304050
MSTTVNVDSLAEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETR
QVAWSKTADKIEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTILY
GTQFVLSTLSLAADSKEDAVNWLSGLKILHQEAMNASTPTIIESWLRKQI
YSVDQTRRNSISLRELKTILPLINFKVSSAKFLKDKFVEIGAHKDELSFE
QFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASAVYLHDFQRFL
IHEQQEHWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDAVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLR
MGCRCIELDCWDGPDGKPVIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFP
VILSIEEHCSVEQQRHMAKAFKEVFGDLLLTKPTEASADQLPSPSQLREK
IIIKHKKLGPRGDVDVNMEDKKDEHKQQGELYMWDSIDQKWTRHYCAIAD
AKLSFSDDIEQTMEEEVPQDIPPTELHFGEKWFHKKVEKRTSAEKLLQEY
CMETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTLKYY
LTDNLTFSSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDS
LSRGEAEDMLMRIPRDGAFLIRKREGSDSYAITFRARGKVKHCRINRDGR
HFVLGTSAYFESLVELVSYYEKHSLYRKMRLRYPVTPELLERYNMERDIN
SLYDVSRMYVDPSEINPSMPQRTVKALYDYKAKRSDELSFCRGALIHNVS
KEPGGWWKGDYGTRIQQYFPSNYVEDISTADFEELEKQIIEDNPLGSLCR
GILDLNTYNVVKAPQGKNQKSFVFILEPKQQGDPPVEFATDRVEELFEWF
QSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENP
DFREIRSFVETKADSIIRQKPVDLLKYNQKGLTRVYPKGQRVDSSNYDPF
RLWLCGSQMVALNFQTADKYMQMNHALFSLNGRTGYVLQPESMRTEKYDP
MPPESQRKILMTLTVKVLGARHLPKLGRSIACPFVEVEICGAEYDNNKFK
TTVVNDNGLSPIWAPTQEKVTFEIYDPNLAFLRFVVYEEDMFSDPNFLAH
ATYPIKAVKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFSVNENQLQLYQEKCN
KRLREKRVSNSKFYS

Кодований геном білок за функціями належить до гідролаз, білків внутрішньоклітинного сигналінгу, фосфопротеїнів. Задіяний у таких біологічних процесах, як метаболізм ліпідів, деградація ліпідів. Білок має сайт для зв'язування з іоном кальцію.

Література[ред. | ред. код]

  • Ohta S., Matsui A., Nazawa Y., Kagawa Y. (1988). Complete cDNA encoding a putative phospholipase C from transformed human lymphocytes.. FEBS Lett. 242: 31 — 35.  PubMed DOI:10.1016/0014-5793(88)80979-7
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Ozdener F., Dangelmaier C., Ashby B., Kunapuli S.P., Daniel J.L. (2002). Activation of phospholipase Cgamma2 by tyrosine phosphorylation.. Mol. Pharmacol. 62: 672 — 679.  PubMed DOI:10.1124/mol.62.3.672

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]