PLCL1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PLCL1
Ідентифікатори
Символи PLCL1, PLCE, PLCL, PLDL1, PPP1R127, PRIP, phospholipase C like 1, phospholipase C like 1 (inactive)
Зовнішні ІД OMIM: 600597 MGI: 3036262 HomoloGene: 38155 GeneCards: PLCL1
Пов'язані генетичні захворювання
alcohol abuse, Хвороба Крона[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006226
NM_001114663
RefSeq (білок)
NP_006217
NP_001108135
Локус (UCSC) Хр. 2: 197.8 – 198.57 Mb Хр. 1: 55.41 – 55.75 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PLCL1 (англ. Phospholipase C like 1 (inactive)) – білок, який кодується однойменним геном, розташованим у людей на 2-й хромосомі.[4] Довжина поліпептидного ланцюга білка становить 1 095 амінокислот, а молекулярна маса — 122 728[5].

Послідовність амінокислот
1020304050
MAEGAAGREDPAPPDAAGGEDDPRVGPDAAGDCVTAASGGRMRDRRSGVA
LPGAAGTPADSEAGLLEAARATPRRSSIIKDPSNQKCGGRKKTVSFSSMP
SEKKISSANDCISFMQAGCELKKVRPNSRIYNRFFTLDTDLQALRWEPSK
KDLEKAKLDISAIKEIRLGKNTETFRNNGLADQICEDCAFSILHGENYES
LDLVANSADVANIWVSGLRYLVSRSKQPLDFMEGNQNTPRFMWLKTVFEA
ADVDGNGIMLEDTSVELIKQLNPTLKEAKIRLKFKEIQKSKEKLTTRVTE
EEFCEAFCELCTRPEVYFLLVQISKNKEYLDANDLMLFLEAEQGVTHITE
DICLDIIRRYELSEEGRQKGFLAIDGFTQYLLSSECDIFDPEQKKVAQDM
TQPLSHYYINASHNTYLIEDQFRGPADINGYIRALKMGCRSVELDVSDGS
DNEPILCNRNNMTTHVSFRSVIEVINKFAFVASEYPLILCLGNHCSLPQQ
KVMAQQMKKVFGNKLYTEAPLPSESYLPSPEKLKRMIIVKGKKLPSDPDV
LEGEVTDEDEEAEMSRRMSVDYNGEQKQIRLCRELSDLVSICKSVQYRDF
ELSMKSQNYWEMCSFSETEASRIANEYPEDFVNYNKKFLSRIYPSAMRID
SSNLNPQDFWNCGCQIVAMNFQTPGPMMDLHTGWFLQNGGCGYVLRPSIM
RDEVSYFSANTKGILPGVSPLALHIKIISGQNFPKPKGACAKGDVIDPYV
CIEIHGIPADCSEQRTKTVQQNSDNPIFDETFEFQVNLPELAMIRFVVLD
DDYIGDEFIGQYTIPFECLQPGYRHVPLRSFVGDIMEHVTLFVHIAITNR
SGGGKAQKRSLSVRMGKKVREYTMLRNIGLKTIDDIFKIAVHPLREAIDM
RENMQNAIVSIKELCGLPPIASLKQCLLTLSSRLITSDNTPSVSLVMKDS
FPYLEPLGAIPDVQKKMLTAYDLMIQESRFLIEMADTVQEKIVQCQKAGM
EFHEELHNLGAKEGLKGRKLNKATESFAWNITVLKGQGDLLKNAKNEAIE
NMKQIQLACLSCGLSKAPSSSAEAKSKRSLEAIEEKESSEENGKL

Кодований геном білок за функціями належить до білків внутрішньоклітинного сигналінгу, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у цитоплазмі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Murakami A., Matsuda M., Nakasima A., Hirata M. (2006). Characterization of the human PRIP-1 gene structure and transcriptional regulation.. Gene 382: 129 — 139.  PubMed DOI:10.1016/j.gene.2006.07.005
  • Kanematsu T., Takeuchi H., Terunuma M., Hirata M. (2005). PRIP, a novel Ins(1,4,5)P3 binding protein, functional significance in Ca2+ signaling and extension to neuroscience and beyond.. Mol. Cells 20: 305 — 314.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]