POU5F1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
POU5F1
Ідентифікатори
Символи POU5F1octamer-binding protein 4POU domainclass 5transcription factor 1POU-type homeodomain-containing DNA-binding proteinPOU class 5 homeobox 1 transcript variant OCT4B3POU class 5 homeobox 1 transcript variant OCT4B1OTF-3octamer-binding protein 3POU classV homeobox 1 variant 2octamer-binding transcription factor 3POU domain transcription factor OCT4POU class 5 homeobox 1 transcript variant OCT4B5POU class 5 homeobox 1 transcript variant OCT4B4POU class 5 homeobox 1 transcript variant OCT4B2Oct-3Oct-4POU class 5 homeobox 1 transcript variant OCT4B6
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE POU5F1 210265 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

POU5F1 (англ. POU class 5 homeobox 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 360 амінокислот, а молекулярна маса — 38 571[2].

Послідовність амінокислот
1020304050
MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPG
VGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAG
VGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFA
KLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKL
RPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFL
QCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEA
AGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSV
TTLGSPMHSN

Кодований геном білок за функціями належить до білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Takeda J., Seino S., Bell G.I. (1992). Human Oct3 gene family: cDNA sequences, alternative splicing, gene organization, chromosomal location, and expression at low levels in adult tissues.. Nucleic Acids Res. 20: 4613 — 4620.  PubMed DOI:10.1093/nar/20.17.4613
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Wey E., Lyons G.E., Schaefer B.W. (1994). A human POU domain gene, mPOU, is expressed in developing brain and specific adult tissues.. Eur. J. Biochem. 220: 753 — 762.  PubMed DOI:10.1111/j.1432-1033.1994.tb18676.x
  • Abdel-Rahman B., Fiddler M., Rappolee D., Pergament E. (1995). Expression of transcription regulating genes in human preimplantation embryos.. Hum. Reprod. 10: 2787 — 2792.  PubMed DOI:10.1093/oxfordjournals.humrep.a135792
  • Lee J., Kim H.K., Han Y.-M., Kim J. (2008). Pyruvate kinase isozyme type M2 (PKM2) interacts and cooperates with Oct-4 in regulating transcription.. Int. J. Biochem. Cell Biol. 40: 1043 — 1054.  PubMed DOI:10.1016/j.biocel.2007.11.009
  • Spelat R., Ferro F., Curcio F. (2012). Serine 111 phosphorylation regulates OCT4A protein subcellular distribution and degradation.. J. Biol. Chem. 287: 38279 — 38288.  PubMed DOI:10.1074/jbc.M112.386755

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:9221 (англ.). Процитовано 6 вересня 2017. 
  2. UniProt, Q01860 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]