PPARG

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PPARG
PPARG.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PPARG, CIMT1, GLM1, NR1C3, PPARG1, PPARG2, PPARgamma, peroxisome proliferator activated receptor gamma
Зовнішні ІД OMIM: 601487 MGI: 97747 HomoloGene: 7899 GeneCards: PPARG
Пов'язані генетичні захворювання
Цукровий діабет 2-го типу, Familial partial lipodystrophy[1]
Реагує на сполуку
rosiglitazone, ciglitazone, Лінолева кислота, mesalamine, netoglitazone, pioglitazone, Troglitazone, farglitazar, Індометацин, bexarotene, bardoxolone methyl, Диклофенак, Резвератрол[2]
Шаблон експресії
PBB GE PPARG 208510 s at.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001127330
NM_011146
NM_001308352
NM_001308354
RefSeq (білок)
NP_001120802
NP_001295281
NP_001295283
NP_035276
Локус (UCSC) Хр. 3: 12.29 – 12.43 Mb Хр. 6: 115.36 – 115.49 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PPARG (англ. Peroxisome proliferator activated receptor gamma) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [5] Довжина поліпептидного ланцюга білка становить 505 амінокислот, а молекулярна маса — 57 620[6].

Послідовність амінокислот
1020304050
MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDL
SVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQ
EYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFH
YGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLA
VGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSY
IKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGV
HEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAV
KFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLK
LNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEI
YKDLY

Кодований геном білок за функціями належить до рецепторів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, біологічні ритми, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Mukherjee R., Jow L., Croston G.E., Paterniti J.R. Jr. (1997). Identification, characterization, and tissue distribution of human peroxisome proliferator-activated receptor (PPAR) isoforms PPARgamma2 versus PPARgamma1 and activation with retinoid X receptor agonists and antagonists.. J. Biol. Chem. 272: 8071 — 8076.  PubMed DOI:10.1074/jbc.272.12.8071
  • Lambe K.G., Tugwood J.D. (1996). A human peroxisome-proliferator-activated receptor-gamma is activated by inducers of adipogenesis, including thiazolidinedione drugs.. Eur. J. Biochem. 239: 1 — 7.  PubMed DOI:10.1111/j.1432-1033.1996.0001u.x
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Caira F., Antonson P., Pelto-Huikko M., Treuter E., Gustafsson J.-A. (2000). Cloning and characterization of RAP250, a nuclear receptor coactivator.. J. Biol. Chem. 275: 5308 — 5317.  PubMed DOI:10.1074/jbc.275.8.5308
  • Shao W., Halachmi S., Brown M. (2002). ERAP140, a conserved tissue-specific nuclear receptor coactivator.. Mol. Cell. Biol. 22: 3358 — 3372.  PubMed DOI:10.1128/MCB.22.10.3358-3372.2002
  • Park U.H., Yoon S.K., Park T., Kim E.J., Um S.J. (2011). Additional sex comb-like (ASXL) proteins 1 and 2 play opposite roles in adipogenesis via reciprocal regulation of peroxisome proliferator-activated receptor {gamma}.. J. Biol. Chem. 286: 1354 — 1363.  PubMed DOI:10.1074/jbc.M110.177816

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]