PVR

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PVR
Poliovirus binding receptor 1DGI.png
Наявні структури
PDBПошук для людей: PDBe RCSB
Ідентифікатори
Символи PVR, CD155, HVED, NECL5, Necl-5, PVS, TAGE4, poliovirus receptor, PVR cell adhesion molecule
Зовнішні ІД OMIM: 173850 HomoloGene: 9672 GeneCards: PVR
Пов'язані генетичні захворювання
Розсіяний склероз[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001135768
NM_001135769
NM_001135770
NM_006505
н/д
RefSeq (білок)
NP_001129240
NP_001129241
NP_001129242
NP_006496
н/д
Локус (UCSC) Хр. 19: 44.64 – 44.67 Mb н/д
PubMed search [2] н/д
Вікідані
Див./Ред. для людей

PVR (англ. Poliovirus receptor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 417 амінокислот, а молекулярна маса — 45 303[4].

Послідовність амінокислот
1020304050
MARAMAAAWPLLLVALLVLSWPPPGTGDVVVQAPTQVPGFLGDSVTLPCY
LQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLG
AELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAE
VQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTV
TVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISG
YDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIR
PVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRNAIIFLVL
GILVFLILLGIGIYFYWSKCSREVLWHCHLCPSSTEHASASANGHVSYSA
VSRENSSSQDPQTEGTR

Кодований геном білок за функціями належить до рецепторів клітини-хазяїна для входу віруса, рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинна адгезія, взаємодія хазяїн-вірус, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані. Також секретований назовні.

Література[ред. | ред. код]

  • Mendelsohn C.L., Wimmer E., Racaniello V.R. (1989). Cellular receptor for poliovirus: molecular cloning, nucleotide sequence, and expression of a new member of the immunoglobulin superfamily.. Cell 56: 855 — 865.  PubMed DOI:10.1016/0092-8674(89)90690-9
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Koike S., Ise I., Nomoto A. (1991). Functional domains of the poliovirus receptor.. Proc. Natl. Acad. Sci. U.S.A. 88: 4104 — 4108.  PubMed DOI:10.1073/pnas.88.10.4104
  • Geraghty R.J., Krummenacher C., Cohen G.H., Eisenberg R.J., Spear P.G. (1998). Entry of alphaherpesviruses mediated by poliovirus receptor-related protein 1 and poliovirus receptor.. Science 280: 1618 — 1620.  PubMed DOI:10.1126/science.280.5369.1618
  • Lange R., Peng X., Wimmer E., Lipp M., Bernhardt G. (2001). The poliovirus receptor CD155 mediates cell-to-matrix contacts by specifically binding to vitronectin.. Virology 285: 218 — 227.  PubMed DOI:10.1006/viro.2001.0943
  • Mueller S., Cao X., Welker R., Wimmer E. (2002). Interaction of the poliovirus receptor CD155 with the dynein light chain Tctex-1 and its implication for poliovirus pathogenesis.. J. Biol. Chem. 277: 7897 — 7904.  PubMed DOI:10.1074/jbc.M111937200

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]