RARG

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
RARG
Protein RARG PDB 1dsz.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи RARG, NR1B3, RARC, retinoic acid receptor gamma
Зовнішні ІД OMIM: 180190 MGI: 97858 HomoloGene: 20263 GeneCards: RARG
Реагує на сполуку
adapalene, alitretinoin, palovarotene, tamibarotene, tazarotene, Третиноїн[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000966
NM_001042728
NM_001243730
NM_001243731
NM_001243732
NM_001042727
NM_011244
RefSeq (білок)
NP_000957
NP_001036193
NP_001230659
NP_001230660
NP_001230661
NP_001036192
NP_035374
Локус (UCSC) Хр. 12: 53.21 – 53.23 Mb Хр. 15: 102.23 – 102.26 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RARG (англ. Retinoic acid receptor gamma) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 454 амінокислот, а молекулярна маса — 50 342[5].

Послідовність амінокислот
1020304050
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLG
QPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGY
HYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKC
FEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQET
FPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPG
FTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH
NAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKV
DKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITL
KMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGL
KSPA

Кодований геном білок за функцією належить до рецепторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Krust A., Kastner P., Petkovich M., Zelent A., Chambon P. (1989). A third human retinoic acid receptor, hRAR-gamma.. Proc. Natl. Acad. Sci. U.S.A. 86: 5310 — 5314.  PubMed DOI:10.1073/pnas.86.14.5310
  • Lehmann J.M., Hoffmann B., Pfahl M. (1991). Genomic organization of the retinoic acid receptor gamma gene.. Nucleic Acids Res. 19: 573 — 578.  PubMed DOI:10.1093/nar/19.3.573
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lehmann J.M., Zhang X.K., Pfahl M. (1992). RAR-gamma-2 expression is regulated through a retinoic acid response element embedded in Sp1 sites.. Mol. Cell. Biol. 12: 2976 — 2985.  PubMed DOI:10.1128/MCB.12.7.2976

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]