RFX1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
RFX1
1dp7 biolunit.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи RFX1, EFC, RFX, regulatory factor X1
Зовнішні ІД OMIM: 600006 MGI: 105982 HomoloGene: 2189 GeneCards: RFX1
Шаблон експресії
PBB GE RFX1 222012 at fs.png

PBB GE RFX1 206321 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002918
NM_009055
RefSeq (білок)
NP_002909
NP_033081
Локус (UCSC) Хр. 19: 13.96 – 14.01 Mb Хр. 8: 84.07 – 84.1 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RFX1 (англ. Regulatory factor X1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 979 амінокислот, а молекулярна маса — 104 758[4].

Послідовність амінокислот
1020304050
MATQAYTELQAAPPPSQPPQAPPQAQPQPPPPPPPAAPQPPQPPTAAATP
QPQYVTELQSPQPQAQPPGGQKQYVTELPAVPAPSQPTGAPTPSPAPQQY
IVVTVSEGAMRASETVSEASPGSTASQTGVPTQVVQQVQGTQQRLLVQTS
VQAKPGHVSPLQLTNIQVPQQALPTQRLVVQSAAPGSKGGQVSLTVHGTQ
QVHSPPEQSPVQANSSSSKTAGAPTGTVPQQLQVHGVQQSVPVTQERSVV
QATPQAPKPGPVQPLTVQGLQPVHVAQEVQQLQQVPVPHVYSSQVQYVEG
GDASYTASAIRSSTYSYPETPLYTQTASTSYYEAAGTATQVSTPATSQAV
ASSGSMPMYVSGSQVVASSTSTGAGASNSSGGGGSGGGGGGGGGGGGGGS
GSTGGGGSGAGTYVIQGGYMLGSASQSYSHTTRASPATVQWLLDNYETAE
GVSLPRSTLYCHYLLHCQEQKLEPVNAASFGKLIRSVFMGLRTRRLGTRG
NSKYHYYGLRIKASSPLLRLMEDQQHMAMRGQPFSQKQRLKPIQKMEGMT
NGVAVGQQPSTGLSDISAQVQQYQQFLDASRSLPDFTELDLQGKVLPEGV
GPGDIKAFQVLYREHCEAIVDVMVNLQFTLVETLWKTFWRYNLSQPSEAP
PLAVHDEAEKRLPKAILVLLSKFEPVLQWTKHCDNVLYQGLVEILIPDVL
RPIPSALTQAIRNFAKSLESWLTHAMVNIPEEMLRVKVAAAGAFAQTLRR
YTSLNHLAQAARAVLQNTAQINQMLSDLNRVDFANVQEQASWVCRCEDRV
VQRLEQDFKVTLQQQNSLEQWAAWLDGVVSQVLKPYQGSAGFPKAAKLFL
LKWSFYSSMVIRDLTLRSAASFGSFHLIRLLYDEYMYYLIEHRVAQAKGE
TPIAVMGEFANLATSLNPLDPDKDEEEEEEEESEDELPQDISLAAGGESP
ALGPETLEPPAKLARTDARGLFVQALPSS

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Safrany G., Perry R.P. (1993). Transcription factor RFX1 helps control the promoter of the mouse ribosomal protein-encoding gene rpL30 by binding to its alpha element.. Gene 132: 279 — 283.  PubMed DOI:10.1016/0378-1119(93)90208-K
  • Sanchez-Herrero C., Reith W., Silacci P., Mach B. (1992). The DNA-binding defect observed in major histocompatibility complex class II regulatory mutants concerns only one member of a family of complexes binding to the X boxes of class II promoters.. Mol. Cell. Biol. 12: 4076 — 4083.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:9982 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P22670 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]