RORA

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
RORA
Protein RORA PDB 1n83.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи RORA, NR1F1, ROR1, ROR2, ROR3, RZR-ALPHA, RZRA, RAR related orphan receptor A, IDDECA
Зовнішні ІД OMIM: 600825 MGI: 104661 HomoloGene: 56594 GeneCards: RORA
Пов'язані генетичні захворювання
шизофренія, бронхіальна астма, Депресія клінічна[1]
Реагує на сполуку
Холестерин[2]
Шаблон експресії
PBB GE RORA 210479 s at fs.png

PBB GE RORA 210426 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002943
NM_134260
NM_134261
NM_134262
NM_013646
NM_001289916
NM_001289917
RefSeq (білок)
NP_002934
NP_599022
NP_599023
NP_599024
NP_001276845
NP_001276846
NP_038674
Локус (UCSC) Хр. 15: 60.49 – 61.23 Mb Хр. 9: 68.65 – 69.39 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RORA (англ. RAR related orphan receptor A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 523 амінокислот, а молекулярна маса — 58 975[6].

Послідовність амінокислот
1020304050
MESAPAAPDPAASEPGSSGADAAAGSRETPLNQESARKSEPPAPVRRQSY
SSTSRGISVTKKTHTSQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRS
QQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSK
KQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDL
SNYIDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPA
SGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHLETCQYLREELQQITW
QTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQN
DQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFI
SFVFEFGKSLCSMHLTEDEIALFSAFVLMSADRSWLQEKVKIEKLQQKIQ
LALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVR
LHFPPLYKELFTSEFEPAMQIDG

Кодований геном білок за функціями належить до рецепторів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Becker-Andre M., Andre E., Delamarter J.F. (1993). Identification of nuclear receptor mRNAs by RT-PCR amplification of conserved zinc-finger motif sequences.. Biochem. Biophys. Res. Commun. 194: 1371 — 1379.  PubMed DOI:10.1006/bbrc.1993.1976
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Harding H.P., Atkins G.B., Jaffe A.B., Seo W.J., Lazar M.A. (1997). Transcriptional activation and repression by RORalpha, an orphan nuclear receptor required for cerebellar development.. Mol. Endocrinol. 11: 1737 — 1746.  PubMed DOI:10.1210/mend.11.11.0002
  • Lau P., Bailey P., Dowhan D.H., Muscat G.E. (1999). Exogenous expression of a dominant negative RORalpha1 vector in muscle cells impairs differentiation: RORalpha1 directly interacts with p300 and myoD.. Nucleic Acids Res. 27: 411 — 420.  PubMed DOI:10.1093/nar/27.2.411
  • Sundvold H., Lien S. (2001). Identification of a novel peroxisome proliferator-activated receptor (PPAR) gamma promoter in man and transactivation by the nuclear receptor RORalpha1.. Biochem. Biophys. Res. Commun. 287: 383 — 390.  PubMed DOI:10.1006/bbrc.2001.5602
  • Moraitis A.N., Giguere V. (2003). The co-repressor hairless protects RORalpha orphan nuclear receptor from proteasome-mediated degradation.. J. Biol. Chem. 278: 52511 — 52518.  PubMed DOI:10.1074/jbc.M308152200

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]