SLMAP

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SLMAP
Ідентифікатори
Символи SLMAP, SLAP, sarcolemma associated protein
Зовнішні ІД OMIM: 602701 MGI: 1933549 HomoloGene: 31428 GeneCards: SLMAP
Пов'язані генетичні захворювання
Ожиріння[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_032008
NM_001310445
NM_001347494
RefSeq (білок)
NP_001297374
NP_001334423
NP_114397
Локус (UCSC) Хр. 3: 57.76 – 57.93 Mb Хр. 14: 26.41 – 26.53 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SLMAP (англ. Sarcolemma associated protein) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 828 амінокислот, а молекулярна маса — 95 198[5].

Послідовність амінокислот
1020304050
MPSALAIFTCRPNSHPFQERHVYLDEPIKIGRSVARCRPAQNNATFDCKV
LSRNHALVWFDHKTGKFYLQDTKSSNGTFINSQRLSRGSEESPPCEILSG
DIIQFGVDVTENTRKVTHGCIVSTIKLFLPDGMEARLRSDVIHAPLPSPV
DKVAANTPSMYSQELFQLSQYLQEALHREQMLEQKLATLQRLLAITQEAS
DTSWQALIDEDRLLSRLEVMGNQLQACSKNQTEDSLRKELIALQEDKHNY
ETTAKESLRRVLQEKIEVVRKLSEVERSLSNTEDECTHLKEMNERTQEEL
RELANKYNGAVNEIKDLSDKLKVAEGKQEEIQQKGQAEKKELQHKIDEME
EKEQELQAKIEALQADNDFTNERLTALQVRLEHLQEKTLKECSSLEHLLS
KSGGDCTFIHQFIECQKKLIVEGHLTKAVEETKLSKENQTRAKESDFSDT
LSPSKEKSSDDTTDAQMDEQDLNEPLAKVSLLKDDLQGAQSEIEAKQEIQ
HLRKELIEAQELARTSKQKCFELQALLEEERKAYRNQVEESTKQIQVLQA
QLQRLHIDTENLREEKDSEITSTRDELLSARDEILLLHQAAAKVASERDT
DIASLQEELKKVRAELERWRKAASEYEKEITSLQNSFQLRCQQCEDQQRE
EATRLQGELEKLRKEWNALETECHSLKRENVLLSSELQRQEKELHNSQKQ
SLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDV
QKEYEKTQTVLSELKLKFEMTEQEKQSITDELKQCKNNLKLLREKGNNKP
WPWMPMLAALVAVTAIVLYVPGLARASP

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі як альтернативний сплайсинг. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O. (2000). Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.. DNA Res. 7: 273 — 281.  PubMed DOI:10.1093/dnares/7.4.271

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]