SNAP29

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SNAP29
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи SNAP29, CEDNIK, SNAP-29, synaptosome associated protein 29kDa, synaptosome associated protein 29
Зовнішні ІД MGI: 1914724 HomoloGene: 3512 GeneCards: SNAP29
Шаблон експресії
PBB GE SNAP29 218327 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004782
NM_023348
RefSeq (білок)
NP_004773
NP_075837
Локус (UCSC) Хр. 22: 20.86 – 20.89 Mb Хр. 16: 17.41 – 17.43 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SNAP29 (англ. Synaptosome associated protein 29) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 22-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 258 амінокислот, а молекулярна маса — 28 970[4].

Послідовність амінокислот
1020304050
MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVL
RRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQ
DLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAI
STSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQ
KIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKS
TERKVRQL

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт, транспорт білків, автофагія, біогенез та деградація війок. Локалізований у клітинній мембрані, цитоплазмі, мембрані, клітинних відростках, війках, цитоплазматичних везикулах, апараті гольджі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Itakura E., Kishi-Itakura C., Mizushima N. (2012). The hairpin-type tail-anchored SNARE syntaxin 17 targets to autophagosomes for fusion with endosomes/lysosomes.. Cell 151: 1256 — 1269.  PubMed DOI:10.1016/j.cell.2012.11.001

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11133 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, O95721 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]