SPTB

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SPTB
Protein SPTB PDB 1s35.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи SPTB, EL3, HS2, HSPTB1, SPH2, spectrin beta, erythrocytic
Зовнішні ІД OMIM: 182870 MGI: 98387 HomoloGene: 295 GeneCards: SPTB
Пов'язані генетичні захворювання
Ожиріння, hereditary spherocytosis type 2[1]
Шаблон експресії
PBB GE SPTB 214145 s at fs.png

PBB GE SPTB 208416 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000347
NM_001024858
NM_001355436
NM_001355437
NM_013675
RefSeq (білок)
NP_001020029
NP_001342365
NP_001342366
н/д
Локус (UCSC) Хр. 14: 64.75 – 64.88 Mb Хр. 12: 76.58 – 76.71 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SPTB (англ. Spectrin beta, erythrocytic) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 2 137 амінокислот, а молекулярна маса — 246 468[5].

Послідовність амінокислот
1020304050
MTSATEFENVGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALAD
EREVVQKKTFTKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEML
PKPTKGKMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLVLGLI
WTIILRFQIQDIVVQTQEGRETRSAKDALLLWCQMKTAGYPHVNVTNFTS
SWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFNVAERQLGIIPL
LDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTV
EKPPKFQEKGNLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLE
EAEYRRELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVAQDNF
GYDLAAVEAAKKKHEAIETDTAAYEERVRALEDLAQELEKENYHDQKRIT
ARKDNILRLWSYLQELLQSRRQRLETTLALQKLFQDMLHSIDWMDEIKAH
LLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLKFTEGKGY
QPCDPQVIQDRISHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAE
SWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLEQIFQEA
HGMVARKQFGHPQIEARIKEVSAQWDQLKDLAAFCKKNLQDAENFFQFQG
DADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKHKDFLEELEESRGVME
HLEQQAQGFPEEFRDSPDVTHRLQALRELYQQVVAQADLRQQRLQEALDL
YTVFGETDACELWMGEKEKWLAEMEMPDTLEDLEVVQHRFDILDQEMKTL
MTQIDGVNLAANSLVESGHPRSREVKQYQDHLNTRWQAFQTLVSERREAV
DSALRVHNYCVDCEETSKWITDKTKVVESTKDLGRDLAGIIAIQRKLSGL
ERDVAAIQARVDALERESQQLMDSHPEQKEDIGQRQKHLEELWQGLQQSL
QGQEDLLGEVSQLQAFLQDLDDFQAWLSITQKAVASEDMPESLPEAEQLL
QQHAGIKDEIDGHQDSYQRVKESGEKVIQGQTDPEYLLLGQRLEGLDTGW
NALGRMWESRSHTLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSL
EAAEAGIRKFEDFLGSMENNRDKVLSPVDSGNKLVAEGNLYSDKIKEKVQ
LIEDRHRKNNEKAQEASVLLRDNLELQNFLQNCQELTLWINDKLLTSQDV
SYDEARNLHNKWLKHQAFVAELASHEGWLENIDAEGKQLMDEKPQFTALV
SQKLEALHRLWDELQATTKEKTQHLSAARSSDLRLQTHADLNKWISAMED
QLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELGELFAQVPSMGEEGG
DADLSIEKRFLDLLEPLGRRKKQLESSRAKLQISRDLEDETLWVEERLPL
AQSADYGTNLQTVQLFMKKNQTLQNEILGHTPRVEDVLQRGQQLVEAAEI
DCQDLEERLGHLQSSWDRLREAAAGRLQRLRDANEAQQYYLDADEAEAWI
GEQELYVISDEIPKDEEGAIVMLKRHLRQQRAVEDYGRNIKQLASRAQGL
LSAGHPEGEQIIRLQGQVDKHYAGLKDVAEERKRKLENMYHLFQLKRETD
DLEQWISEKELVASSPEMGQDFDHVTLLRDKFRDFARETGAIGQERVDNV
NAFIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLH
RYFYTGAEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGV
QVQQFQDVATRLQTAYAGEKAEAIQNKEQEVSAAWQALLDACAGRRTQLV
DTADKFRFFSMARDLLSWMESIIRQIETQERPRDVSSVELLMKYHQGINA
EIETRSKNFSACLELGESLLQRQHQASEEIREKLQQVMSRRKEMNEKWEA
RWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHTVDSVEKLIKR
HEAFEKSTASWAERFAALEKPTTLELKERQIAERPAEETGPQEEEGETAG
EAPVSHHAATERTSPVSLWSRLSSSWESLQPEPSHPY

Кодований геном білок за функціями належить до кепінгів актину, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з молекулою актину. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Yoon S.H., Kentros C.G., Prchal J.T. (1990). Identification of an unusual deletion within homologous repeats of human reticulocyte beta-spectrin and probable peptide polymorphism.. Gene 91: 297 — 302.  PubMed DOI:10.1016/0378-1119(90)90104-Y
  • Speicher D.W., Marchesi V.T. (1984). Erythrocyte spectrin is comprised of many homologous triple helical segments.. Nature 311: 177 — 180.  PubMed DOI:10.1038/311177a0
  • Tang H.Y., Speicher D.W. (2004). In vivo phosphorylation of human erythrocyte spectrin occurs in a sequential manner.. Biochemistry 43: 4251 — 4262.  PubMed DOI:10.1021/bi036092x
  • Maciag M., Plochocka D., Adamowicz-Salach A., Burzynska B. (2009). Novel beta-spectrin mutations in hereditary spherocytosis associated with decreased levels of mRNA.. Br. J. Haematol. 146: 326 — 332.  PubMed DOI:10.1111/j.1365-2141.2009.07759.x
  • Kusunoki H., MacDonald R.I., Mondragon A. (2004). Structural insights into the stability and flexibility of unusual erythroid spectrin repeats.. Structure 12: 645 — 656.  PubMed DOI:10.1016/j.str.2004.02.022
  • Maillet P., Alloisio N., Morle L., Delaunay J. (1996). Spectrin mutations in hereditary elliptocytosis and hereditary spherocytosis.. Hum. Mutat. 8: 97 — 107.  PubMed DOI:10.1002/(SICI)1098-1004(1996)8:2<97::AID-HUMU1>3.3.CO;2-W

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]