SPTBN1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SPTBN1
Protein SPTBN1 PDB 1aa2.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи SPTBN1, ELF, HEL102, SPTB2, betaSpII, spectrin beta, non-erythrocytic 1
Зовнішні ІД OMIM: 182790 MGI: 98388 HomoloGene: 2354 GeneCards: SPTBN1
Пов'язані генетичні захворювання
короткозорість[1]
Шаблон експресії
PBB GE SPTBN1 215918 s at fs.png

PBB GE SPTBN1 200672 x at fs.png

PBB GE SPTBN1 200671 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003128
NM_178313
NM_009260
NM_175836
RefSeq (білок)
NP_003119
NP_842565
NP_033286
NP_787030
Локус (UCSC) Хр. 2: 54.46 – 54.67 Mb Хр. 11: 30.1 – 30.27 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SPTBN1 (англ. Spectrin beta, non-erythrocytic 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 2 364 амінокислот, а молекулярна маса — 274 609[5].

Послідовність амінокислот
1020304050
MTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKALAD
EREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERL
PKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLI
WTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTT
SWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKL
LDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIET
EKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTV
EKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLE
KAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNF
GFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRIT
ARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVL
VLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEG
YKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEE
EGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKE
GEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQ
ADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTL
DTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLA
LYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNN
QASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDA
LLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTG
MERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTT
LKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKL
LTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTG
WNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTT
LEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKV
DSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQD
MSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAV
VKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLE
SQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEG
KSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILW
VGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQN
IVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFD
AAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQ
LSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRL
FQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNI
GQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQI
LAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFE
HDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDAC
ESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLM
NNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRK
EMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVD
EVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRP
PSPEPSTKVSEEAESQQQWDTSKGEQVSQNGLPAEQGSPRMAETVDTSEM
VNGATEQRTSSKESSPIPSPTSDRKAKTALPAQSAATLPARTQETPSAQM
EGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKTAASGIPYH
SEVPVSLKEAVCEVALDYKKKKHVFKLRLNDGNEYLFQAKDDEEMNTWIQ
AISSAISSDKHEVSASTQSTPASSRAQTLPTSVVTITSESSPGKREKDKE
KDKEKRFSLFGKKK

Кодований геном білок за функцією належить до кепінгів актину. Білок має сайт для зв'язування з молекулою актину, молекулою кальмодуліну. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані.

Література[ред. | ред. код]

  • Chen Y., Yu P., Lu D., Tagle D.A., Cai T. (2001). A novel isoform of beta-spectrin II localizes to cerebellar Purkinje-cell bodies and interacts with neurofibromatosis type 2 gene product schwannomin.. J. Mol. Neurosci. 17: 59 — 70.  PubMed DOI:10.1385/JMN:17:1:59
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Mohler P.J., Yoon W., Bennett V. (2004). Ankyrin-B targets beta2-spectrin to an intracellular compartment in neonatal cardiomyocytes.. J. Biol. Chem. 279: 40185 — 40193.  PubMed DOI:10.1074/jbc.M406018200
  • Carugo K.D., Banuelos S., Saraste M. (1997). Crystal structure of a calponin homology domain.. Nat. Struct. Biol. 4: 175 — 179.  PubMed DOI:10.1038/nsb0397-175
  • Banuelos S., Saraste M., Carugo K.D. (1998). Structural comparisons of calponin homology domains: implications for actin binding.. Structure 6: 1419 — 1431.  PubMed DOI:10.1016/S0969-2126(98)00141-5
  • Hu R.J., Watanabe M., Bennett V. (1992). Characterization of human brain cDNA encoding the general isoform of beta-spectrin.. J. Biol. Chem. 267: 18715 — 18722.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]