SRF

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SRF
Ідентифікатори
Символи c-fos serum response element-binding transcription factorminichromosome maintenance 1 homologSRFserum response factor
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE SRF 202401 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

SRF (англ. Serum response factor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 508 амінокислот, а молекулярна маса — 51 593[2].

Послідовність амінокислот
1020304050
MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAG
LGPGRLEREAAAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKR
SLSEMEIGMVVGGPEASAAATGGYGPVSGAVSGAKPGKKTRGRVKIKMEF
IDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATR
KLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATGFEETDLTYQV
SESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPIT
NYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGA
VAQQVPVQAIQVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVP
TTVGGHMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSHSQVQE
PGGVPQVFLTASSGTVQIPVSAVQLHQMAVIGQQAGSSSNLTELQVVNLD
TAHSTKSE

Кодований геном білок за функціями належить до активаторів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі. Бере участь у проліферації клітин до гладенько-м'язових в асоціації з міокардином.[3]

Література[ред. | ред. код]

  • Norman C., Runswick M., Pollock R., Treisman R. (1988). Isolation and properties of cDNA clones encoding SRF, a transcription factor that binds to the c-fos serum response element.. Cell 55: 989 — 1003.  PubMed DOI:10.1016/0092-8674(88)90244-9
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Janknecht R., Ernst W.H., Houthaeve T., Nordheim A. (1993). C-terminal phosphorylation of the serum-response factor.. Eur. J. Biochem. 216: 469 — 475.  PubMed DOI:10.1111/j.1432-1033.1993.tb18165.x
  • Liu Z.-P., Wang Z., Yanagisawa H., Olson E.N. (2005). Phenotypic modulation of smooth muscle cells through interaction of Foxo4 and myocardin.. Dev. Cell 9: 261 — 270.  PubMed DOI:10.1016/j.devcel.2005.05.017
  • Sundberg-Smith L.J., DiMichele L.A., Sayers R.L., Mack C.P., Taylor J.M. (2008). The LIM protein leupaxin is enriched in smooth muscle and functions as an serum response factor cofactor to induce smooth muscle cell gene transcription.. Circ. Res. 102: 1502 — 1511.  PubMed DOI:10.1161/CIRCRESAHA.107.170357
  • Shi N., Guo X., Chen S.Y. (2014). Olfactomedin 2, a novel regulator for transforming growth factor-beta-induced smooth muscle differentiation of human embryonic stem cell-derived mesenchymal cells.. Mol. Biol. Cell 25: 4106 — 4114.  PubMed DOI:10.1091/mbc.E14-08-1255

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:11291 (англ.). Процитовано 6 вересня 2017. 
  2. UniProt, P11831 (англ.). Процитовано 6 вересня 2017. 
  3. Du, Kevin L.; Ip, Hon S.; Li, Jian; Chen, Mary; Dandre, Frederic; Yu, William; Lu, Min Min; Owens, Gary K. та ін. (2003-4). Myocardin Is a Critical Serum Response Factor Cofactor in the Transcriptional Program Regulating Smooth Muscle Cell Differentiation. Molecular and Cellular Biology 23 (7). с. 2425–2437. ISSN 0270-7306. PMID 12640126. doi:10.1128/MCB.23.7.2425-2437.2003. Процитовано 2018-12-21. 

Див. також[ред. | ред. код]