SRY

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SRY
Ідентифікатори
Символи Testis-determining factoressential protein for sex determination in human malessex-determining region Y proteintestis-determining factor on YSRYsex-determining region on Ytruncated sex-determining region Y protein
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

SRY (від англ. sex determining region Y — «ділянка Y-хромосоми, що визначає стать») — білок, який кодується однойменним геном, розташованим у людей на короткому плечі Y-хромосоми.[1] Довжина поліпептидного ланцюга білка становить 204 амінокислот, а молекулярна маса — 23 884[2].

Послідовність амінокислот
1020304050
MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGE
NSKGNVQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKM
LTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPKNCSLLPADPA
SVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSH
WTKL

Кодований геном білок за функціями належить до репресорів, активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, диференціація клітин, ацетилювання. Білок має сайт для зв'язування з молекулою кальмодуліну, ДНК. Локалізований у цитоплазмі, ядрі.

SRY є безінтронним геном, він відповідає за процес статевої диференціації на ембріональній стадії розвитку в плацентарних і сумчастих ссавців, появу чоловічих статевих ознак, генез внутрішніх і зовнішніх статевих органів.

Література[ред. | ред. код]

  • Behlke M.A., Bogan J.S., Beer-Romero P., Page D.C. (1993). Evidence that the SRY protein is encoded by a single exon on the human Y chromosome.. Genomics 17: 736 — 739.  PubMed DOI:10.1006/geno.1993.1395
  • Whitfield L.S., Hawkins J.R., Goodfellow P.N., Sulston J. (1995). 41 kilobases of analyzed sequence from the pseudoautosomal and sex-determining regions of the short arm of the human Y chromosome.. Genomics 27: 306 — 311.  PubMed DOI:10.1006/geno.1995.1047
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • King C.Y., Weiss M.A. (1993). The SRY high-mobility-group box recognizes DNA by partial intercalation in the minor groove: a topological mechanism of sequence specificity.. Proc. Natl. Acad. Sci. U.S.A. 90: 11990 — 11994.  PubMed DOI:10.1073/pnas.90.24.11990
  • Giese K., Pagel J., Grosschedl R. (1994). Distinct DNA-binding properties of the high mobility group domain of murine and human SRY sex-determining factors.. Proc. Natl. Acad. Sci. U.S.A. 91: 3368 — 3372.  PubMed DOI:10.1073/pnas.91.8.3368
  • Mayer A., Lahr G., Swaab D.F., Pilgrim C., Reisert I. (1998). The Y-chromosomal genes SRY and ZFY are transcribed in adult human brain.. Neurogenetics 1: 281 — 288.  PubMed DOI:10.1007/s100480050042

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:11311 (англ.). Процитовано 12 вересня 2017. 
  2. UniProt, Q05066 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]