STMN1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
STMN1
Ідентифікатори
Символи STMN1, C1orf215, LAP18, Lag, OP18, PP17, PP19, PR22, SMN, stathmin 1
Зовнішні ІД OMIM: 151442 MGI: 96739 HomoloGene: 4063 GeneCards: STMN1
Шаблон експресії
PBB GE STMN1 200783 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_203401
NM_001145454
NM_005563
NM_152497
NM_203399
NM_019641
RefSeq (білок)
NP_001138926
NP_005554
NP_981944
NP_981946
NP_062615
Локус (UCSC) Хр. 1: 25.88 – 25.91 Mb Хр. 4: 134.47 – 134.47 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

STMN1 (англ. Stathmin 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 149 амінокислот, а молекулярна маса — 17 303[4].

Послідовність амінокислот
1020304050
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEI
QKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEK
LTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

Кодований геном білок за функцією належить до білків розвитку. Задіяний у таких біологічних процесах як диференціація, нейрогенез. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Maucuer A., Doye V., Sobel A. (1990). A single amino acid difference distinguishes the human and the rat sequences of stathmin, a ubiquitous intracellular phosphoprotein associated with cell regulations.. FEBS Lett. 264: 275 — 278.  PubMed DOI:10.1016/0014-5793(90)80266-L
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Brattsand G., Marklund U., Nylander K., Roos G., Gullberg M. (1994). Cell-cycle-regulated phosphorylation of oncoprotein 18 on Ser16, Ser25 and Ser38.. Eur. J. Biochem. 220: 359 — 368.  PubMed DOI:10.1111/j.1432-1033.1994.tb18632.x
  • Leong W.F., Chow V.T. (2006). Transcriptomic and proteomic analyses of rhabdomyosarcoma cells reveal differential cellular gene expression in response to enterovirus 71 infection.. Cell. Microbiol. 8: 565 — 580.  PubMed DOI:10.1111/j.1462-5822.2005.00644.x
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240
  • Melhem R.F., Zhu X., Hailat N., Strahler J.R., Hanash S.M. (1991). Characterization of the gene for a proliferation-related phosphoprotein (oncoprotein 18) expressed in high amounts in acute leukemia.. J. Biol. Chem. 266: 17747 — 17753.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6510 (англ.). Процитовано 25 серпня 2017. 
  4. UniProt, P16949 (англ.). Процитовано 25 серпня 2017. 

Див. також[ред. | ред. код]