TAF1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TAF1
Protein TAF1 PDB 1eqf.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TAF1, BA2R, CCG1, CCGS, DYT3, DYT3/KAT4, N-NSCL2, OF, P250, TAF(II)250, TAF2A, TAFII-250, TAFII250, XDP, MRXS33, TATA-box binding protein associated factor 1
Зовнішні ІД OMIM: 313650 MGI: 1336878 HomoloGene: 37942 GeneCards: TAF1
Пов'язані генетичні захворювання
X-linked dystonia-parkinsonism[1]
Шаблон експресії
PBB GE TAF1 216711 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001286074
NM_004606
NM_138923
NM_001081008
NM_001290729
RefSeq (білок)
NP_001273003
NP_004597
NP_620278
NP_001277658
Локус (UCSC) Хр. X: 71.37 – 71.53 Mb Хр. X: 101.53 – 101.6 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TAF1 (англ. TATA-box binding protein associated factor 1) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[4] Довжина поліпептидного ланцюга білка становить 1 872 амінокислот, а молекулярна маса — 212 677[5].

Послідовність амінокислот
1020304050
MGPGCDLLLRTAATITAAAIMSDTDSDEDSAGGGPFSLAGFLFGNINGAG
QLEGESVLDDECKKHLAGLGALGLGSLITELTANEELTGTDGALVNDEGW
VRSTEDAVDYSDINEVAEDESRRYQQTMGSLQPLCHSDYDEDDYDADCED
IDCKLMPPPPPPPGPMKKDKDQDSITGEKVDFSSSSDSESEMGPQEATQA
ESEDGKLTLPLAGIMQHDATKLLPSVTELFPEFRPGKVLRFLRLFGPGKN
VPSVWRSARRKRKKKHRELIQEEQIQEVECSVESEVSQKSLWNYDYAPPP
PPEQCLSDDEITMMAPVESKFSQSTGDIDKVTDTKPRVAEWRYGPARLWY
DMLGVPEDGSGFDYGFKLRKTEHEPVIKSRMIEEFRKLEENNGTDLLADE
NFLMVTQLHWEDDIIWDGEDVKHKGTKPQRASLAGWLPSSMTRNAMAYNV
QQGFAATLDDDKPWYSIFPIDNEDLVYGRWEDNIIWDAQAMPRLLEPPVL
TLDPNDENLILEIPDEKEEATSNSPSKESKKESSLKKSRILLGKTGVIKE
EPQQNMSQPEVKDPWNLSNDEYYYPKQQGLRGTFGGNIIQHSIPAVELRQ
PFFPTHMGPIKLRQFHRPPLKKYSFGALSQPGPHSVQPLLKHIKKKAKMR
EQERQASGGGEMFFMRTPQDLTGKDGDLILAEYSEENGPLMMQVGMATKI
KNYYKRKPGKDPGAPDCKYGETVYCHTSPFLGSLHPGQLLQAFENNLFRA
PIYLHKMPETDFLIIRTRQGYYIRELVDIFVVGQQCPLFEVPGPNSKRAN
THIRDFLQVFIYRLFWKSKDRPRRIRMEDIKKAFPSHSESSIRKRLKLCA
DFKRTGMDSNWWVLKSDFRLPTEEEIRAMVSPEQCCAYYSMIAAEQRLKD
AGYGEKSFFAPEEENEEDFQMKIDDEVRTAPWNTTRAFIAAMKGKCLLEV
TGVADPTGCGEGFSYVKIPNKPTQQKDDKEPQPVKKTVTGTDADLRRLSL
KNAKQLLRKFGVPEEEIKKLSRWEVIDVVRTMSTEQARSGEGPMSKFARG
SRFSVAEHQERYKEECQRIFDLQNKVLSSTEVLSTDTDSSSAEDSDFEEM
GKNIENMLQNKKTSSQLSREREEQERKELQRMLLAAGSAASGNNHRDDDT
ASVTSLNSSATGRCLKIYRTFRDEEGKEYVRCETVRKPAVIDAYVRIRTT
KDEEFIRKFALFDEQHREEMRKERRRIQEQLRRLKRNQEKEKLKGPPEKK
PKKMKERPDLKLKCGACGAIGHMRTNKFCPLYYQTNAPPSNPVAMTEEQE
EELEKTVIHNDNEELIKVEGTKIVLGKQLIESADEVRRKSLVLKFPKQQL
PPKKKRRVGTTVHCDYLNRPHKSIHRRRTDPMVTLSSILESIINDMRDLP
NTYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYPSREEFREHLE
LIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARLEKAINPLLD
DDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDL
ETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVC
YQTLTEYDEHLTQLEKDICTAKEAALEEAELESLDPMTPGPYTPQPPDLY
DTNTSLSMSRDASVFQDESNMSVLDIPSATPEKQVTQEGEDGDGDLADEE
EGTVQQPQASVLYEDLLMSEGEDDEEDAGSDEEGDNPFSAIQLSESGSDS
DVGSGGIRPKQPRMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISY
GSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLS
EDEEDSEDFHSIAGDSDLDSDE

Кодований геном білок за функціями належить до трансфераз, кіназ, серин/треонінових протеїнкіназ, ацилтрансфераз, фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, клітинний цикл, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Sekiguchi T., Nohiro Y., Nakamura Y., Hisamoto N., Nishimoto T. (1991). The human CCG1 gene, essential for progression of the G1 phase, encodes a 210-kilodalton nuclear DNA-binding protein.. Mol. Cell. Biol. 11: 3317 — 3325.  PubMed DOI:10.1128/MCB.11.6.3317
  • Ruppert S., Wang E.H., Tjian R. (1993). Cloning and expression of human TAFII250: a TBP-associated factor implicated in cell-cycle regulation.. Nature 362: 175 — 179.  PubMed DOI:10.1038/362175a0
  • Nolte D., Niemann S., Muller U. (2003). Specific sequence changes in multiple transcript system DYT3 are associated with X-linked dystonia parkinsonism.. Proc. Natl. Acad. Sci. U.S.A. 100: 10347 — 10352.  PubMed DOI:10.1073/pnas.1831949100
  • Herzfeld T., Nolte D., Muller U. (2007). Structural and functional analysis of the human TAF1/DYT3 multiple transcript system.. Mamm. Genome 18: 787 — 795.  PubMed DOI:10.1007/s00335-007-9063-z
  • Dikstein R., Ruppert S., Tjian R. (1996). TAFII250 is a bipartite protein kinase that phosphorylates the base transcription factor RAP74.. Cell 84: 781 — 790.  PubMed DOI:10.1016/S0092-8674(00)81055-7
  • Damania B., Alwine J.C. (1996). TAF-like function of SV40 large T antigen.. Genes Dev. 10: 1369 — 1381.  PubMed DOI:10.1101/gad.10.11.1369

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]