TAF4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TAF4
Protein TAF4 PDB 1h3o.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TAF4, TAF2C, TAF2C1, TAF4A, TAFII130, TAFII135, TATA-box binding protein associated factor 4
Зовнішні ІД OMIM: 601796 MGI: 2152346 HomoloGene: 55723 GeneCards: TAF4
Шаблон експресії
PBB GE TAF4 208545 x at fs.png

PBB GE TAF4 213090 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003185
NM_001081092
RefSeq (білок)
NP_003176
NP_001074561
Локус (UCSC) Хр. 20: 61.95 – 62.07 Mb Хр. 2: 179.91 – 179.98 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TAF4 (англ. TATA-box binding protein associated factor 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 085 амінокислот, а молекулярна маса — 110 114[4].

Послідовність амінокислот
1020304050
MAAGSDLLDEVFFNSEVDEKVVSDLVGSLESQLAASAAHHHHLAPRTPEV
RAAAAGALGNHVVSGSPAGAAGAGPAAPAEGAPGAAPEPPPAGRARPGGG
GPQRPGPPSPRRPLVPAGPAPPAAKLRPPPEGSAGSCAPVPAAAAVAAGP
EPAPAGPAKPAGPAALAARAGPGPGPGPGPGPGPGPGKPAGPGAAQTLNG
SAALLNSHHAAAPAVSLVNNGPAALLPLPKPAAPGTVIQTPPFVGAAAPP
APAAPSPPAAPAPAAPAAAPPPPPPAPATLARPPGHPAGPPTAAPAVPPP
AAAQNGGSAGAAPAPAPAAGGPAGVSGQPGPGAAAAAPAPGVKAESPKRV
VQAAPPAAQTLAASGPASTAASMVIGPTMQGALPSPAAVPPPAPGTPTGL
PKGAAGAVTQSLSRTPTATTSGIRATLTPTVLAPRLPQPPQNPTNIQNFQ
LPPGMVLVRSENGQLLMIPQQALAQMQAQAHAQPQTTMAPRPATPTSAPP
VQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSATLQRSPGVQPQL
VLGGAAQTASLGTATAVQTGTPQRTVPGATTTSSAATETMENVKKCKNFL
STLIKLASSGKQSTETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQ
PYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPPTSQATTALTAVVLSS
SVQRTAGKTAATVTSALQPPVLSLTQPTQVGVGKQGQPTPLVIQQPPKPG
ALIRPPQVTLTQTPMVALRQPHNRIMLTTPQQIQLNPLQPVPVVKPAVLP
GTKALSAVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESA
RILATNSELVGTLTRSCKDETFLLQAPLQRRILEIGKKHGITELHPDVVS
YVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQL
DQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMR
QRDANLTALAAIGPRKKRKVDCPGPGSGAEGSGPGSVVPGSSGVGTPRQF
TRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції. Локалізований у ядрі.

Література[ред. | ред. код]

  • Mengus G., May M., Carre L., Chambon P., Davidson I. (1997). Human TAF(II)135 potentiates transcriptional activation by the AF-2s of the retinoic acid, vitamin D3, and thyroid hormone receptors in mammalian cells.. Genes Dev. 11: 1381 — 1395.  PubMed DOI:10.1101/gad.11.11.1381
  • Tanese N., Saluja D., Vassallo M.F., Chen J.-L., Admon A. (1996). Molecular cloning and analysis of two subunits of the human TFIID complex: hTAFII130 and hTAFII100.. Proc. Natl. Acad. Sci. U.S.A. 93: 13611 — 13616.  PubMed DOI:10.1073/pnas.93.24.13611
  • Damania B., Alwine J.C. (1996). TAF-like function of SV40 large T antigen.. Genes Dev. 10: 1369 — 1381.  PubMed DOI:10.1101/gad.10.11.1369
  • Brand M., Yamamoto K., Staub A., Tora L. (1999). Identification of TATA-binding protein-free TAFII-containing complex subunits suggests a role in nucleosome acetylation and signal transduction.. J. Biol. Chem. 274: 18285 — 18289.  PubMed DOI:10.1074/jbc.274.26.18285
  • Cavusoglu N., Brand M., Tora L., van Dorsselaer A. (2003). Novel subunits of the TATA binding protein free TAFII-containing transcription complex identified by matrix-assisted laser desorption/ionization-time of flight mass spectrometry following one-dimensional gel electrophoresis.. Proteomics 3: 217 — 223.  PubMed DOI:10.1002/pmic.200390030

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11537 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, O00268 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]