TAF5

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TAF5
Protein TAF5 PDB 2nxp.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TAF5, TAF2D, TAFII100, TAF(II)100, TAFII-100, TATA-box binding protein associated factor 5
Зовнішні ІД OMIM: 601787 MGI: 2442144 HomoloGene: 5064 GeneCards: TAF5
Шаблон експресії
PBB GE TAF5 210053 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006951
NM_139052
NM_177342
RefSeq (білок)
NP_008882
NP_620640
NP_796316
Локус (UCSC) Хр. 10: 103.37 – 103.39 Mb Хр. 19: 47.07 – 47.08 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TAF5 (англ. TATA-box binding protein associated factor 5) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 800 амінокислот, а молекулярна маса — 86 830[4].

Послідовність амінокислот
1020304050
MAALAEEQTEVAVKLEPEGPPTLLPPQAGDGAGEGSGGTTNNGPNGGGGN
VAASSSTGGDGGTPKPTVAVSAAAPAGAAPVPAAAPDAGAPHDRQTLLAV
LQFLRQSKLREAEEALRREAGLLEEAVAGSGAPGEVDSAGAEVTSALLSR
VTASAPGPAAPDPPGTGASGATVVSGSASGPAAPGKVGSVAVEDQPDVSA
VLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLE
LVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDF
RTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFDGMPRSKQ
QIDAMVGSLAGEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKP
KKKKPKKDSIGSKSKKQDPNAPPQNRIPLPELKDSDKLDKIMNMKETTKR
VRLGPDCLPSICFYTFLNAYQGLTAVDVTDDSSLIAGGFADSTVRVWSVT
PKKLRSVKQASDLSLIDKESDDVLERIMDEKTASELKILYGHSGPVYGAS
FSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGYYF
VSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRT
VRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGH
GLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETD
DFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ

Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, альтернативний сплайсинг. Локалізований у ядрі.

Література[ред. | ред. код]

  • Tanese N., Saluja D., Vassallo M.F., Chen J.-L., Admon A. (1996). Molecular cloning and analysis of two subunits of the human TFIID complex: hTAFII130 and hTAFII100.. Proc. Natl. Acad. Sci. U.S.A. 93: 13611 — 13616.  PubMed DOI:10.1073/pnas.93.24.13611
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Damania B., Alwine J.C. (1996). TAF-like function of SV40 large T antigen.. Genes Dev. 10: 1369 — 1381.  PubMed DOI:10.1101/gad.10.11.1369
  • Brand M., Yamamoto K., Staub A., Tora L. (1999). Identification of TATA-binding protein-free TAFII-containing complex subunits suggests a role in nucleosome acetylation and signal transduction.. J. Biol. Chem. 274: 18285 — 18289.  PubMed DOI:10.1074/jbc.274.26.18285
  • Cavusoglu N., Brand M., Tora L., van Dorsselaer A. (2003). Novel subunits of the TATA binding protein free TAFII-containing transcription complex identified by matrix-assisted laser desorption/ionization-time of flight mass spectrometry following one-dimensional gel electrophoresis.. Proteomics 3: 217 — 223.  PubMed DOI:10.1002/pmic.200390030
  • Bhattacharya S., Takada S., Jacobson R.H. (2007). Structural analysis and dimerization potential of the human TAF5 subunit of TFIID.. Proc. Natl. Acad. Sci. U.S.A. 104: 1189 — 1194.  PubMed DOI:10.1073/pnas.0610297104

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11539 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q15542 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]