TAF9

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TAF9
Protein TAF9 PDB 1rkb.png
Ідентифікатори
Символи TAF9, MGC:5067, STAF31/32, TAF2G, TAFII-31, TAFII-32, TAFII31, TAFII32, TAFIID32, TATA-box binding protein associated factor 9
Зовнішні ІД OMIM: 600822 MGI: 1888697 HomoloGene: 39986 GeneCards: TAF9
Шаблон експресії
PBB GE TAF9 202168 at fs.png

PBB GE TAF9 203893 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003187
NM_001015892
NM_001015889
NM_027139
RefSeq (білок)
NP_001015892
NP_003178
NP_001015889
NP_081415
Локус (UCSC) Хр. 5: 69.36 – 69.37 Mb Хр. 13: 100.65 – 100.66 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TAF9 (англ. TATA-box binding protein associated factor 9) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 264 амінокислот, а молекулярна маса — 28 974[4].

Послідовність амінокислот
1020304050
MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTI
LDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRN
QTPLPLIKPYSGPRLPPDRYCLTAPNYRLKSLQKKASTSAGRITVPRLSV
GSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTGQRFTVQMPTSQSPAVK
ASIPATSAVQNVLINPSLIGSKNILITTNMMSSQNTANESSNALKRKRED
DDDDDDDDDDYDNL

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, поліморфізм. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Lu H., Levine A.J. (1995). Human TAFII31 protein is a transcriptional coactivator of the p53 protein.. Proc. Natl. Acad. Sci. U.S.A. 92: 5154 — 5158.  PubMed DOI:10.1073/pnas.92.11.5154
  • Klemm R.D., Goodrich J.A., Zhou S., Tjian R. (1995). Molecular cloning and expression of the 32-kDa subunit of human TFIID reveals interactions with VP16 and TFIIB that mediate transcriptional activation.. Proc. Natl. Acad. Sci. U.S.A. 92: 5788 — 5792.  PubMed DOI:10.1073/pnas.92.13.5788
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11542 (англ.). Процитовано 5 вересня 2017. 
  4. UniProt, Q16594 (англ.). Процитовано 5 вересня 2017. 

Див. також[ред. | ред. код]