TBX22

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TBX22
Ідентифікатори
Символи TBX22, ABERS, CLPA, CPX, TBXX, dJ795G23.1, T-box 22, T-box transcription factor 22
Зовнішні ІД OMIM: 300307 MGI: 2389465 HomoloGene: 9666 GeneCards: TBX22
Пов'язані генетичні захворювання
X-linked cleft palate with or without ankyloglossia, Abruzzo–Erickson syndrome[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001109878
NM_001109879
NM_001303475
NM_016954
NM_001290747
NM_145224
NM_181319
RefSeq (білок)
NP_001103348
NP_001103349
NP_001290404
NP_058650
NP_001277676
NP_660259
NP_851836
Локус (UCSC) Хр. X: 80.01 – 80.03 Mb Хр. X: 107.67 – 107.69 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TBX22 (англ. T-box 22) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[4] Довжина поліпептидного ланцюга білка становить 520 амінокислот, а молекулярна маса — 57 910[5].

Послідовність амінокислот
1020304050
MALSSRARAFSVEALVGRPSKRKLQDPIQAEQPELREKKGGEEEEERRSS
AAGKSEPLEKQPKTEPSTSASSGCGSDSGYGNSSESLEEKDIQMELQGSE
LWKRFHDIGTEMIITKAGRRMFPSVRVKVKGLDPGKQYHVAIDVVPVDSK
RYRYVYHSSQWMVAGNTDHLCIIPRFYVHPDSPCSGETWMRQIISFDRMK
LTNNEMDDKGHIILQSMHKYKPRVHVIEQGSSVDLSQIQSLPTEGVKTFS
FKETEFTTVTAYQNQQITKLKIERNPFAKGFRDTGRNRGVLDGLLETYPW
RPSFTLDFKTFGADTQSGSSGSSPVTSSGGAPSPLNSLLSPLCFSPMFHL
PTSSLGMPCPEAYLPNVNLPLCYKICPTNFWQQQPLVLPAPERLASSNSS
QSLAPLMMEVPMLSSLGVTNSKSGSSEDSSDQYLQAPNSTNQMLYGLQSP
GNIFLPNSITPEALSCSFHPSYDFYRYNFSMPSRLISGSNHLKVNDDSQV
SFGEGKCNHVHWYPAINHYL

Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Laugier-Anfossi F., Villard L. (2000). Molecular characterization of a new human T-box gene (TBX22) located in Xq21.1 encoding a protein containing a truncated T-domain.. Gene 255: 289 — 296.  PubMed DOI:10.1016/S0378-1119(00)00326-7
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]