TCOF1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TCOF1
Ідентифікатори
Символи TCOF1, MFD1, TCS, TCS1, treacle, treacle ribosome biogenesis factor 1
Зовнішні ІД OMIM: 606847 MGI: 892003 HomoloGene: 68049 GeneCards: TCOF1
Шаблон експресії
PBB GE TCOF1 202385 s at fs.png

PBB GE TCOF1 202384 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001198984
NM_011552
RefSeq (білок)
NP_001185913
NP_035682
Локус (UCSC) Хр. 5: 150.36 – 150.4 Mb Хр. 18: 60.81 – 60.85 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TCOF1 (англ. Treacle ribosome biogenesis factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 1 488 амінокислот, а молекулярна маса — 152 106[4].

Послідовність амінокислот
1020304050
MAEARKRRELLPLIYHHLLRAGYVRAAREVKEQSGQKCFLAQPVTLLDIY
THWQQTSELGRKRKAEEDAALQAKKTRVSDPISTSESSEEEEEAEAETAK
ATPRLASTNSSVLGADLPSSMKEKAKAETEKAGKTGNSMPHPATGKTVAN
LLSGKSPRKSAEPSANTTLVSETEEEGSVPAFGAAAKPGMVSAGQADSSS
EDTSSSSDETDVEGKPSVKPAQVKASSVSTKESPARKAAPAPGKVGDVTP
QVKGGALPPAKRAKKPEEESESSEEGSESEEEAPAGTRSQVKASEKILQV
RAASAPAKGTPGKGATPAPPGKAGAVASQTKAGKPEEDSESSSEESSDSE
EETPAAKALLQAKASGKTSQVGAASAPAKESPRKGAAPAPPGKTGPAVAK
AQAGKREEDSQSSSEESDSEEEAPAQAKPSGKAPQVRAASAPAKESPRKG
AAPAPPRKTGPAAAQVQVGKQEEDSRSSSEESDSDREALAAMNAAQVKPL
GKSPQVKPASTMGMGPLGKGAGPVPPGKVGPATPSAQVGKWEEDSESSSE
ESSDSSDGEVPTAVAPAQEKSLGNILQAKPTSSPAKGPPQKAGPVAVQVK
AEKPMDNSESSEESSDSADSEEAPAAMTAAQAKPALKIPQTKACPKKTNT
TASAKVAPVRVGTQAPRKAGTATSPAGSSPAVAGGTQRPAEDSSSSEESD
SEEEKTGLAVTVGQAKSVGKGLQVKAASVPVKGSLGQGTAPVLPGKTGPT
VTQVKAEKQEDSESSEEESDSEEAAASPAQVKTSVKKTQAKANPAAARAP
SAKGTISAPGKVVTAAAQAKQRSPSKVKPPVRNPQNSTVLARGPASVPSV
GKAVATAAQAQTGPEEDSGSSEEESDSEEEAETLAQVKPSGKTHQIRAAL
APAKESPRKGAAPTPPGKTGPSAAQAGKQDDSGSSSEESDSDGEAPAAVT
SAQVIKPPLIFVDPNRSPAGPAATPAQAQAASTPRKARASESTARSSSSE
SEDEDVIPATQCLTPGIRTNVVTMPTAHPRIAPKASMAGASSSKESSRIS
DGKKQEGPATQVSKKNPASLPLTQAALKVLAQKASEAQPPVARTQPSSGV
DSAVGTLPATSPQSTSVQAKGTNKLRKPKLPEVQQATKAPESSDDSEDSS
DSSSGSEEDGEGPQGAKSAHTLGPTPSRTETLVEETAAESSEDDVVAPSQ
SLLSGYMTPGLTPANSQASKATPKLDSSPSVSSTLAAKDDPDGKQEAKPQ
QAAGMLSPKTGGKEAASGTTPQKSRKPKKGAGNPQASTLALQSNITQCLL
GQPWPLNEAQVQASVVKVLTELLEQERKKVVDTTKESSRKGWESRKRKLS
GDQPAARTPRSKKKKKLGAGEGGEASVSPEKTSTTSKGKAKRDKASGDVK
EKKGKGSLGSQGAKDEPEEELQKGMGTVEGGDQSNPKSKKEKKKSDKRKK
DKEKKEKKKKAKKASTKDSESPSQKKKKKKKKTAEQTV

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як поліморфізм, ацетилювання, альтернативний сплайсинг. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240
  • Impens F., Radoshevich L., Cossart P., Ribet D. (2014). Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.. Proc. Natl. Acad. Sci. U.S.A. 111: 12432 — 12437.  PubMed DOI:10.1073/pnas.1413825111
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033
  • Edwards S.J., Gladwin A.J., Dixon M.J. (1997). The mutational spectrum in Treacher Collins syndrome reveals a predominance of mutations that create a premature-termination codon.. Am. J. Hum. Genet. 60: 515 — 524.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11654 (англ.). Процитовано 31 серпня 2017. 
  4. UniProt, Q13428 (англ.). Процитовано 31 серпня 2017. 

Див. також[ред. | ред. код]