TGFA

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TGFA
Protein TGFA PDB 1mox.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TGFA, TFGA, transforming growth factor alpha, Transforming growth factor - α
Зовнішні ІД OMIM: 190170 MGI: 98724 HomoloGene: 2431 GeneCards: TGFA
Шаблон експресії
PBB GE TGFA 205016 at fs.png

PBB GE TGFA 205015 s at fs.png

PBB GE TGFA 211258 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001099691
NM_001308158
NM_001308159
NM_003236
NM_031199
RefSeq (білок)
NP_001093161
NP_001295087
NP_001295088
NP_003227
NP_112476
NP_001390047
Локус (UCSC) Хр. 2: 70.45 – 70.55 Mb Хр. 6: 86.17 – 86.25 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TGFA (англ. Transforming growth factor alpha) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 160 амінокислот, а молекулярна маса — 17 006[4].

Послідовність амінокислот
1020304050
MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDS
HTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAI
TALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGR
TACCHSETVV

Кодований геном білок за функціями належить до факторів росту, мітогенів. Задіяний у таких біологічних процесах як поліморфізм, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані. Також секретований назовні.

Література[ред. | ред. код]

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11765 (англ.). Архів оригіналу за 28 травня 2017. Процитовано 28 серпня 2017. 
  4. UniProt, P01135 (англ.). Архів оригіналу за 25 вересня 2017. Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]