THRB

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
THRB
Protein THRB PDB 1bsx.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи THRB, C-ERBA-2, C-ERBA-BETA, ERBA2, GRTH, NR1A2, PRTH, THR1, THRB1, THRB2, thyroid hormone receptor beta
Зовнішні ІД OMIM: 190160 MGI: 98743 HomoloGene: 36025 GeneCards: THRB
Реагує на сполуку
DL-3,3',5'-triiodothyronine, tiratricol, Трийодтиронін, Левотироксин[1]
Шаблон експресії
PBB GE THRB 207044 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001113417
NM_009380
RefSeq (білок)
NP_001106888
NP_033406
Локус (UCSC) Хр. 3: 24.12 – 24.5 Mb Хр. 14: 17.66 – 18.04 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

THRB (англ. Thyroid hormone receptor beta) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 461 амінокислот, а молекулярна маса — 52 788[5].

Послідовність амінокислот
1020304050
MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK
NEQSSPHLIQTTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSY
LDKDELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYEGK
CVIDKVTRNQCQECRFKKCIYVGMATDLVLDDSKRLAKRKLIEENREKRR
REELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDI
GQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCED
QIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVS
DAIFDLGMSLSSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFL
LAFEHYINYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTEL
FPPLFLEVFED

Кодований геном білок за функцією належить до рецепторів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Sakurai A., Nakai A., Degroot L.J. (1990). Structural analysis of human thyroid hormone receptor beta gene.. Mol. Cell. Endocrinol. 71: 83 — 91.  PubMed DOI:10.1016/0303-7207(90)90245-4
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Frankton S., Harvey C.B., Gleason L.M., Fadel A., Williams G.R. (2004). Multiple messenger ribonucleic acid variants regulate cell-specific expression of human thyroid hormone receptor beta1.. Mol. Endocrinol. 18: 1631 — 1642.  PubMed DOI:10.1210/me.2003-0346
  • Shao W., Halachmi S., Brown M. (2002). ERAP140, a conserved tissue-specific nuclear receptor coactivator.. Mol. Cell. Biol. 22: 3358 — 3372.  PubMed DOI:10.1128/MCB.22.10.3358-3372.2002
  • Rastinejad F., Perlmann T., Evans R.M., Sigler P.B. (1995). Structural determinants of nuclear receptor assembly on DNA direct repeats.. Nature 375: 203 — 211.  PubMed DOI:10.1038/375203a0
  • Parrilla R., Mixson A.J., McPherson J.A., McClaskey J.H., Weintraub B.D. (1991). Characterization of seven novel mutations of the c-erbA beta gene in unrelated kindreds with generalized thyroid hormone resistance. Evidence for two 'hot spot' regions of the ligand binding domain.. J. Clin. Invest. 88: 2123 — 2130.  PubMed DOI:10.1172/JCI115542

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]