TLR6

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TLR6
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TLR6, CD286, toll like receptor 6
Зовнішні ІД OMIM: 605403 MGI: 1341296 HomoloGene: 21223 GeneCards: TLR6
Шаблон експресії
PBB GE TLR6 207446 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006068
NM_011604
NM_001359180
RefSeq (білок)
NP_006059
NP_035734
NP_001346109
Локус (UCSC) Хр. 4: 38.82 – 38.86 Mb Хр. 5: 64.95 – 64.96 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TLR6 (англ. Toll like receptor 6) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 796 амінокислот, а молекулярна маса — 91 880[4].

Послідовність амінокислот
1020304050
MTKDKEPIVKSFHFVCLMIIIVGTRIQFSDGNEFAVDKSKRGLIHVPKDL
PLKTKVLDMSQNYIAELQVSDMSFLSELTVLRLSHNRIQLLDLSVFKFNQ
DLEYLDLSHNQLQKISCHPIVSFRHLDLSFNDFKALPICKEFGNLSQLNF
LGLSAMKLQKLDLLPIAHLHLSYILLDLRNYYIKENETESLQILNAKTLH
LVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIKFLSELTRGST
LLNFTLNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYS
KTTLKALTIEHITNQVFLFSQTALYTVFSEMNIMMLTISDTPFIHMLCPH
APSTFKFLNFTQNVFTDSIFEKCSTLVKLETLILQKNGLKDLFKVGLMTK
DMPSLEILDVSWNSLESGRHKENCTWVESIVVLNLSSNMLTDSVFRCLPP
RIKVLDLHSNKIKSVPKQVVKLEALQELNVAFNSLTDLPGCGSFSSLSVL
IIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELREFVKNIDQVSSE
VLEGWPDSYKCDYPESYRGSPLKDFHMSELSCNITLLIVTIGATMLVLAV
TVTSLCIYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSE
HDSAWVKSELVPYLEKEDIQICLHERNFVPGKSIVENIINCIEKSYKSIF
VLSPNFVQSEWCHYELYFAHHNLFHEGSNNLILILLEPIPQNSIPNKYHK
LKALMTQRTYLQWPKEKSKRGLFWANIRAAFNMKLTLVTENNDVKS

Кодований геном білок за функцією належить до рецепторів. Задіяний у таких біологічних процесах як імунітет, вроджений імунітет, запальна відповідь, поліморфізм, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані, цитоплазматичних везикулах, апараті гольджі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Bulut Y., Faure E., Thomas L., Equils O., Arditi M. (2001). Cooperation of Toll-like receptor 2 and 6 for cellular activation by soluble tuberculosis factor and Borrelia burgdorferi outer surface protein A lipoprotein: role of Toll-interacting protein and IL-1 receptor signaling molecules in Toll-like receptor 2 signaling.. J. Immunol. 167: 987 — 994.  PubMed DOI:10.4049/jimmunol.167.2.987
  • Jang T.H., Park H.H. (2014). Crystal structure of TIR domain of TLR6 reveals novel dimeric interface of TIR-TIR interaction for toll-like receptor signaling pathway.. J. Mol. Biol. 426: 3305 — 3313.  PubMed DOI:10.1016/j.jmb.2014.07.024

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:16711 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, Q9Y2C9 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]