TMOD1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TMOD1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TMOD1, D9S57E, ETMOD, TMOD, tropomodulin 1
Зовнішні ІД OMIM: 190930 MGI: 98775 HomoloGene: 20701 GeneCards: TMOD1
Пов'язані генетичні захворювання
Ожиріння[1]
Шаблон експресії
PBB GE TMOD1 203662 s at fs.png

PBB GE TMOD1 203661 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003275
NM_001166116
NM_021883
RefSeq (білок)
NP_001159588
NP_003266
NP_068683
Локус (UCSC) Хр. 9: 97.5 – 97.6 Mb Хр. 4: 46.04 – 46.12 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TMOD1 (англ. Tropomodulin 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 359 амінокислот, а молекулярна маса — 40 569[5].

Послідовність амінокислот
1020304050
MSYRRELEKYRDLDEDEILGALTEEELRTLENELDELDPDNALLPAGLRQ
KDQTTKAPTGPFKREELLDHLEKQAKEFKDREDLVPYTGEKRGKVWVPKQ
KPLDPVLESVTLEPELEEALANASDAELCDIAAILGMHTLMSNQQYYQAL
SSSSIMNKEGLNSVIKPTQYKPVPDEEPNSTDVEETLERIKNNDPKLEEV
NLNNIRNIPIPTLKAYAEALKENSYVKKFSIVGTRSNDPVAYALAEMLKE
NKVLKTLNVESNFISGAGILRLVEALPYNTSLVEMKIDNQSQPLGNKVEM
EIVSMLEKNATLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRLADLTGP
IIPKCRSGV

Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з молекулою актину. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Chu X., Thompson D., Yee L.J., Sung L.A. (2000). Genomic organization of mouse and human erythrocyte tropomodulin genes encoding the pointed end capping protein for the actin filaments.. Gene 256: 271 — 281.  PubMed DOI:10.1016/S0378-1119(00)00327-9
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Sung L.A., Lin J.J.-C. (1994). Erythrocyte tropomodulin binds to the N-terminus of hTM5, a tropomyosin isoform encoded by the gamma-tropomyosin gene.. Biochem. Biophys. Res. Commun. 201: 627 — 634.  PubMed DOI:10.1006/bbrc.1994.1747

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]