TNFRSF8

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TNFRSF8
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TNFRSF8, CD30, D1S166E, Ki-1, tumor necrosis factor receptor superfamily member 8, TNF receptor superfamily member 8
Зовнішні ІД OMIM: 153243 MGI: 99908 HomoloGene: 949 GeneCards: TNFRSF8
Шаблон експресії
PBB GE TNFRSF8 206729 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001243
NM_001281430
NM_152942
NM_009401
RefSeq (білок)
NP_001234
NP_001268359
NP_033427
Локус (UCSC) Хр. 1: 12.06 – 12.14 Mb Хр. 4: 145.27 – 145.32 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TNFRSF8 (англ. TNF receptor superfamily member 8) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 595 амінокислот, а молекулярна маса — 63 747[4].

Послідовність амінокислот
1020304050
MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPM
GLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAW
NSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCE
PASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRL
AQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYL
DEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARC
VPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSP
TQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVG
SSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSG
ASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDL
PEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEE
ELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK

Кодований геном білок за функцією належить до рецепторів. Локалізований у клітинній мембрані, цитоплазмі, мембрані.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lee S.Y., Park C.G., Choi Y. (1996). T cell receptor-dependent cell death of T cell hybridomas mediated by the CD30 cytoplasmic domain in association with tumor necrosis factor receptor-associated factors.. J. Exp. Med. 183: 669 — 674.  PubMed DOI:10.1084/jem.183.2.669
  • Boucher L.-M., Marengere L.E., Lu Y., Thukral S., Mak T.W. (1997). Binding sites of cytoplasmic effectors TRAF1, 2, and 3 on CD30 and other members of the TNF receptor superfamily.. Biochem. Biophys. Res. Commun. 233: 592 — 600.  PubMed DOI:10.1006/bbrc.1997.6509
  • Ye H., Park Y.C., Kreishman M., Kieff E., Wu H. (1999). The structural basis for the recognition of diverse receptor sequences by TRAF2.. Mol. Cell 4: 321 — 330.  PubMed DOI:10.1016/S1097-2765(00)80334-2

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11923 (англ.). Процитовано 25 серпня 2017. 
  4. UniProt, P28908 (англ.). Процитовано 25 серпня 2017. 

Див. також[ред. | ред. код]