TNNC1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TNNC1
Protein TNNC1 PDB 1aj4.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TNNC1, CMD1Z, CMH13, TN-C, TNC, TNNC, Troponin C type 1, troponin C1, slow skeletal and cardiac type
Зовнішні ІД OMIM: 191040 MGI: 98779 HomoloGene: 55728 GeneCards: TNNC1
Пов'язані генетичні захворювання
dilated cardiomyopathy 1Z, hypertrophic cardiomyopathy 13[1]
Шаблон експресії
PBB GE TNNC1 209904 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003280
NM_009393
RefSeq (білок)
NP_003271
NP_033419
Локус (UCSC) Хр. 3: 52.45 – 52.45 Mb Хр. 14: 31.21 – 31.21 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TNNC1 (англ. Troponin C1, slow skeletal and cardiac type) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 161 амінокислот, а молекулярна маса — 18 403[5].

Послідовність амінокислот
1020304050
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQ
NPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDL
FRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDY
DEFLEFMKGVE

Кодований геном білок за функціями належить до м'язових білків, фосфопротеїнів. Задіяний у таких біологічних процесах як поліморфізм, ацетиляція. Білок має сайт для зв'язування з іонами металів, іоном кальцію.

Література[ред. | ред. код]

  • Roher A., Lieska N., Spitz W. (1986). The amino acid sequence of human cardiac troponin-C.. Muscle Nerve 9: 73 — 77.  PubMed DOI:10.1002/mus.880090112
  • Gahlmann R., Wade R., Gunning R., Kedes L. (1988). Differential expression of slow and fast skeletal muscle troponin C. Slow skeletal muscle troponin C is expressed in human fibroblasts.. J. Mol. Biol. 201: 379 — 391.  PubMed DOI:10.1016/0022-2836(88)90145-3
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Takeda S., Kobayashi T., Taniguchi H., Hayashi H., Maeda Y. (1997). Structural and functional domains of the troponin complex revealed by limited digestion.. Eur. J. Biochem. 246: 611 — 617.  PubMed DOI:10.1111/j.1432-1033.1997.00611.x
  • Lindhout D.A., Sykes B.D. (2003). Structure and dynamics of the C-domain of human cardiac troponin C in complex with the inhibitory region of human cardiac troponin I.. J. Biol. Chem. 278: 27024 — 27034.  PubMed DOI:10.1074/jbc.M302497200
  • Hoffmann B., Schmidt-Traub H., Perrot A., Osterziel K.J., Gessner R. (2001). First mutation in cardiac troponin C, L29Q, in a patient with hypertrophic cardiomyopathy.. Hum. Mutat. 17: 524 — 524.  PubMed DOI:10.1002/humu.1143

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]