TNNI3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TNNI3
Protein TNNI3 PDB 1j1d.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TNNI3, CMD1FF, CMD2A, CMH7, RCM1, TNNC1, cTnI, troponin I3, cardiac type
Зовнішні ІД OMIM: 191044 MGI: 98783 HomoloGene: 309 GeneCards: TNNI3
Пов'язані генетичні захворювання
hypertrophic cardiomyopathy 7, dilated cardiomyopathy 2A, dilated cardiomyopathy 1FF[1]
Шаблон експресії
PBB GE TNNI3 205742 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000363
NM_009406
RefSeq (білок)
NP_000354
NP_000354.4
NP_033432
Локус (UCSC) Хр. 19: 55.15 – 55.16 Mb Хр. 7: 4.52 – 4.52 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TNNI3 (англ. Troponin I3, cardiac type) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 210 амінокислот, а молекулярна маса — 24 008[5].

Послідовність амінокислот
1020304050
MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLK
TLLLQIAKQELEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQL
HARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRIS
ADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSG
MEGRKKKFES

Кодований геном білок за функціями належить до м'язових білків, фосфопротеїнів. Задіяний у такому біологічному процесі, як ацетилювання. Білок має сайт для зв'язування з молекулою актину, іонами металів, іоном кальцію.

Література[ред. | ред. код]

  • Armour K.L., Harris W.J., Tempest P.R. (1993). Cloning and expression in Escherichia coli of the cDNA encoding human cardiac troponin I.. Gene 131: 287 — 292.  PubMed DOI:10.1016/0378-1119(93)90308-P
  • Hunkeler N.M., Kullman J., Murphy A.M. (1991). Troponin I isoform expression in human heart.. Circ. Res. 69: 1409 — 1414.  PubMed DOI:10.1161/01.RES.69.5.1409
  • Bhavsar P.K., Brand N.J., Yacoub M.H., Barton P.J.R. (1996). Isolation and characterization of the human cardiac troponin I gene (TNNI3).. Genomics 35: 11 — 23.  PubMed DOI:10.1006/geno.1996.0317
  • Mittmann K., Jaquet K., Heilmeyer L.M.G. Jr. (1990). A common motif of two adjacent phosphoserines in bovine, rabbit and human cardiac troponin I.. FEBS Lett. 273: 41 — 45.  PubMed DOI:10.1016/0014-5793(90)81046-Q
  • Buscemi N., Foster D.B., Neverova I., Van Eyk J.E. (2002). p21-activated kinase increases the calcium sensitivity of rat triton-skinned cardiac muscle fiber bundles via a mechanism potentially involving novel phosphorylation of troponin I.. Circ. Res. 91: 509 — 516.  PubMed DOI:10.1161/01.RES.0000035246.27856.53
  • Li M.X., Spyracopoulos L., Sykes B.D. (1999). Binding of cardiac troponin-I147-163 induces a structural opening in human cardiac troponin-C.. Biochemistry 38: 8289 — 8298.  PubMed DOI:10.1021/bi9901679

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]