TOMM34

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TOMM34
Ідентифікатори
Символи TOMM34, HTOM34P, TOM34, URCC3, translocase of outer mitochondrial membrane 34
Зовнішні ІД OMIM: 616049 MGI: 1914395 HomoloGene: 4956 GeneCards: TOMM34
Шаблон експресії
PBB GE TOMM34 201870 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006809
NM_001291155
NM_025996
RefSeq (білок)
NP_006800
NP_001278084
NP_080272
Локус (UCSC) Хр. 20: 44.94 – 44.96 Mb Хр. 2: 164.05 – 164.07 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TOMM34 (англ. Translocase of outer mitochondrial membrane 34) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 309 амінокислот, а молекулярна маса — 34 559[4].

Послідовність амінокислот
1020304050
MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEE
SVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEK
YPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLV
PVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEG
NELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDC
TEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKL
RQEVKQNLH

Кодований геном білок за функціями належить до шаперонів, фосфопротеїнів. Локалізований у цитоплазмі, мембрані, мітохондрії, зовнішній мембрані мітохондрій.

Література[ред. | ред. код]

  • Nuttall S.D., Hanson B.J., Mori M., Hoogenraad N.J. (1997). hTom34: a novel translocase for the import of proteins into human mitochondria.. DNA Cell Biol. 16: 1067 — 1074.  PubMed DOI:10.1089/dna.1997.16.1067
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Young J.C., Obermann W.M., Hartl F.U. (1998). Specific binding of tetratricopeptide repeat proteins to the C-terminal 12-kDa domain of hsp90.. J. Biol. Chem. 273: 18007 — 18010.  PubMed DOI:10.1074/jbc.273.29.18007
  • Chewawiwat N., Yano M., Terada K., Hoogenraad N.J., Mori M. (1999). Characterization of the novel mitochondrial protein import component, Tom34, in mammalian cells.. J. Biochem. 125: 721 — 727.  PubMed DOI:10.1093/oxfordjournals.jbchem.a022342
  • Mukhopadhyay A., Avramova L.V., Weiner H. (2002). Tom34 unlike Tom20 does not interact with the leader sequences of mitochondrial precursor proteins.. Arch. Biochem. Biophys. 400: 97 — 104.  PubMed DOI:10.1006/abbi.2002.2777
  • Yang C.-S., Weiner H. (2002). Yeast two-hybrid screening identifies binding partners of human Tom34 that have ATPase activity and form a complex with Tom34 in the cytosol.. Arch. Biochem. Biophys. 400: 105 — 110.  PubMed DOI:10.1006/abbi.2002.2778

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:15746 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q15785 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]