TPM1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TPM1
Protein TPM1 PDB 1c1g.png
Ідентифікатори
Символи TPM1, C15orf13, CMD1Y, CMH3, HTM-alpha, LVNC9, TMSA, HEL-S-265, tropomyosin 1 (alpha), tropomyosin 1
Зовнішні ІД OMIM: 191010 HomoloGene: 121635 GeneCards: TPM1
Пов'язані генетичні захворювання
hypertrophic cardiomyopathy 3, dilated cardiomyopathy 1Y[1]
Шаблон експресії
PBB GE TPM1 206116 s at fs.png

PBB GE TPM1 210987 x at fs.png

PBB GE TPM1 210986 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001002119
RefSeq (білок)
н/д
Локус (UCSC) Хр. 15: 63.04 – 63.07 Mb н/д
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TPM1 (англ. Tropomyosin 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 284 амінокислот, а молекулярна маса — 32 709[5].

Послідовність амінокислот
1020304050
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKL
KGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELD
RAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKE
AKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTV
TNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLE
KSIDDLEDELYAQKLKYKAISEELDHALNDMTSI

Кодований геном білок за функціями належить до м'язових білків, фосфопротеїнів. Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з молекулою актину. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Mische S.M., Manjula B.N., Fischetti V.A. (1987). Relation of streptococcal M protein with human and rabbit tropomyosin: the complete amino acid sequence of human cardiac alpha tropomyosin, a highly conserved contractile protein.. Biochem. Biophys. Res. Commun. 142: 813 — 818.  PubMed DOI:10.1016/0006-291X(87)91486-0
  • Lin C.-S., Leavitt J. (1988). Cloning and characterization of a cDNA encoding transformation-sensitive tropomyosin isoform 3 from tumorigenic human fibroblasts.. Mol. Cell. Biol. 8: 160 — 168.  PubMed DOI:10.1128/MCB.8.1.160
  • McLeod A.R., Gooding C. (1988). Human hTM alpha gene: expression in muscle and nonmuscle tissue.. Mol. Cell. Biol. 8: 433 — 440.  PubMed DOI:10.1128/MCB.8.1.433
  • Denz C.R., Narshi A., Zajdel R.W., Dube D.K. (2004). Expression of a novel cardiac-specific tropomyosin isoform in humans.. Biochem. Biophys. Res. Commun. 320: 1291 — 1297.  PubMed DOI:10.1016/j.bbrc.2004.06.084
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Houle F., Poirier A., Dumaresq J., Huot J. (2007). DAP kinase mediates the phosphorylation of tropomyosin-1 downstream of the ERK pathway, which regulates the formation of stress fibers in response to oxidative stress.. J. Cell Sci. 120: 3666 — 3677.  PubMed DOI:10.1242/jcs.003251

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]