TPM2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TPM2
Ідентифікатори
Символи TPM2, AMCD1, DA1, DA2B, HEL-S-273, NEM4, TMSB, tropomyosin 2 (beta), tropomyosin 2, DA2B4
Зовнішні ІД OMIM: 190990 HomoloGene: 134045 GeneCards: TPM2
Пов'язані генетичні захворювання
nemaline myopathy 4[1]
Шаблон експресії
PBB GE TPM2 212654 at fs.png

PBB GE TPM2 204083 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001145822
NM_001301226
NM_001301227
NM_003289
NM_213674
н/д
RefSeq (білок)
NP_001288155
NP_001288156
NP_003280
NP_998839
н/д
Локус (UCSC) Хр. 9: 35.68 – 35.69 Mb н/д
PubMed search [2] н/д
Вікідані
Див./Ред. для людей

TPM2 (англ. Tropomyosin 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 284 амінокислот, а молекулярна маса — 32 851[4].

Послідовність амінокислот
1020304050
MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKL
KGTEDEVEKYSESVKEAQEKLEQAEKKATDAEADVASLNRRIQLVEEELD
RAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMELQEMQLKE
AKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESKCGDLEEELKIV
TNNLKSLEAQADKYSTKEDKYEEEIKLLEEKLKEAETRAEFAERSVAKLE
KTIDDLEDEVYAQKMKYKAISEELDNALNDITSL

Кодований геном білок за функціями належить до м'язових білків, фосфопротеїнів. Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з молекулою актину. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Widada J.S., Ferraz C., Capony J.-P., Liautard J.-P. (1988). Complete nucleotide sequence of the adult skeletal isoform of human skeletal muscle beta-tropomyosin.. Nucleic Acids Res. 16: 3109 — 3109.  PubMed DOI:10.1093/nar/16.7.3109
  • Prasad G.L., Meissner S., Sheer D.G., Cooper H.L. (1991). A cDNA encoding a muscle-type tropomyosin cloned from a human epithelial cell line: identity with human fibroblast tropomyosin TM1.. Biochem. Biophys. Res. Commun. 177: 1068 — 1075.  PubMed DOI:10.1016/0006-291X(91)90647-P
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Tajsharghi H., Ohlsson M., Lindberg C., Oldfors A. (2007). Congenital myopathy with nemaline rods and cap structures caused by a mutation in the beta-tropomyosin gene (TPM2).. Arch. Neurol. 64: 1334 — 1338.  PubMed DOI:10.1001/archneur.64.9.1334
  • Tajsharghi H., Kimber E., Holmgren D., Tulinius M., Oldfors A. (2007). Distal arthrogryposis and muscle weakness associated with a beta-tropomyosin mutation.. Neurology 68: 772 — 775.  PubMed DOI:10.1212/01.wnl.0000256339.40667.fb
  • Libri D., Mouly V., Lemonnier M., Fiszman M.Y. (1990). A nonmuscle tropomyosin is encoded by the smooth/skeletal beta-tropomyosin gene and its RNA is transcribed from an internal promoter.. J. Biol. Chem. 265: 3471 — 3473.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]