TUBA1C

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TUBA1C
Protein TUBA1C PDB 1ffx.png
Ідентифікатори
Символи TUBA1C, TUBA6, bcm948, tubulin alpha 1c
Зовнішні ІД MGI: 1095409 HomoloGene: 69045 GeneCards: TUBA1C
Шаблон експресії
PBB GE TUBA1C 211750 x at fs.png

PBB GE TUBA1C 212639 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_032704
NM_001303114
NM_001303115
NM_001303116
NM_001303117
NM_009448
RefSeq (білок)
NP_001290043
NP_001290044
NP_001290045
NP_001290046
NP_116093
NP_033474
Локус (UCSC) Хр. 12: 49.19 – 49.27 Mb Хр. 15: 99.03 – 99.04 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TUBA1C (англ. Tubulin alpha 1c) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 449 амінокислот, а молекулярна маса — 49 895[4].

Послідовність амінокислот
1020304050
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFN
TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAA
NNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFT
SLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDC
AFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNV
DLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG
FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYA
KRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSADGEDEGEEY

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як ацетилювання. Білок має сайт для зв'язування з нуклеотидами, ГТФ. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Valenstein M.L., Roll-Mecak A. (2016). Graded control of microtubule severing by tubulin glutamylation.. Cell 164: 911 — 921.  PubMed DOI:10.1016/j.cell.2016.01.019
  • Nirschl J.J., Magiera M.M., Lazarus J.E., Janke C., Holzbaur E.L. (2016). Alpha-tubulin tyrosination and CLIP-170 phosphorylation regulate the initiation of dynein-driven transport in neurons.. Cell Rep. 14: 2637 — 2652.  PubMed DOI:10.1016/j.celrep.2016.02.046

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:20768 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q9BQE3 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]