Альфа-тубулін 4A

Матеріал з Вікіпедії — вільної енциклопедії.
(Перенаправлено з TUBA4A)
Перейти до навігації Перейти до пошуку
Альфа-тубулін 4A
Protein TUBA4A PDB 1ffx.png
Ідентифікатори
Символи TUBA4A, H2-ALPHA, TUBA1, ALS22, tubulin alpha 4a
Зовнішні ІД OMIM: 191110 MGI: 1095410 HomoloGene: 68496 GeneCards: TUBA4A
Пов'язані генетичні захворювання
amyotrohpic lateral sclerosis type 22[1]
Шаблон експресії
PBB GE TUBA4A 212242 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001278552
NM_006000
NM_009447
NM_001313723
NM_001313724
RefSeq (білок)
NP_001265481
NP_005991
NP_001300652
NP_001300653
NP_033473
Локус (UCSC) Хр. 2: 219.25 – 219.28 Mb Хр. 1: 75.21 – 75.22 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Альфа-тубулін 4A (англ. Tubulin alpha 4a) – білок, який кодується геном TUBA4A, розташованим у людей на короткому плечі 2-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 448 амінокислот, а молекулярна маса — 49 924[5].

Послідовність амінокислот
1020304050
MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFT
TFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAA
NNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFT
SLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDC
AFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNV
DLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTG
FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYA
KRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE

Білок має сайт для зв'язування з нуклеотидами, ГТФ. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Dobner P.R., Kislauskis E., Wentworth B.M., Villa-Komaroff L. (1987). Alternative 5' exons either provide or deny an initiator methionine codon to the same alpha-tubulin coding region.. Nucleic Acids Res. 15: 199 — 218.  PubMed DOI:10.1093/nar/15.1.199
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Valenstein M.L., Roll-Mecak A. (2016). Graded control of microtubule severing by tubulin glutamylation.. Cell 164: 911 — 921.  PubMed DOI:10.1016/j.cell.2016.01.019

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]