UTRN

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
UTRN
Ідентифікатори
Символи DRP-1utrophinUTRNdystrophin-related protein 1
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

UTRN (англ. Utrophin) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 3 433 амінокислот, а молекулярна маса — 394 466[2].

Послідовність амінокислот
1020304050
MAKYGEHEASPDNGQNEFSDIIKSRSDEHNDVQKKTFTKWINARFSKSGK
PPINDMFTDLKDGRKLLDLLEGLTGTSLPKERGSTRVHALNNVNRVLQVL
HQNNVELVNIGGTDIVDGNHKLTLGLLWSIILHWQVKDVMKDVMSDLQQT
NSEKILLSWVRQTTRPYSQVNVLNFTTSWTDGLAFNAVLHRHKPDLFSWD
KVVKMSPIERLEHAFSKAQTYLGIEKLLDPEDVAVQLPDKKSIIMYLTSL
FEVLPQQVTIDAIREVETLPRKYKKECEEEAINIQSTAPEEEHESPRAET
PSTVTEVDMDLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEEVKDQFA
THEAFMMELTAHQSSVGSVLQAGNQLITQGTLSDEEEFEIQEQMTLLNAR
WEALRVESMDRQSRLHDVLMELQKKQLQQLSAWLTLTEERIQKMETCPLD
DDVKSLQKLLEEHKSLQSDLEAEQVKVNSLTHMVVIVDENSGESATAILE
DQLQKLGERWTAVCRWTEERWNRLQEINILWQELLEEQCLLKAWLTEKEE
ALNKVQTSNFKDQKELSVSVRRLAILKEDMEMKRQTLDQLSEIGQDVGQL
LDNSKASKKINSDSEELTQRWDSLVQRLEDSSNQVTQAVAKLGMSQIPQK
DLLETVRVREQAITKKSKQELPPPPPPKKRQIHVDIEAKKKFDAISAELL
NWILKWKTAIQTTEIKEYMKMQDTSEMKKKLKALEKEQRERIPRADELNQ
TGQILVEQMGKEGLPTEEIKNVLEKVSSEWKNVSQHLEDLERKIQLQEDI
NAYFKQLDELEKVIKTKEEWVKHTSISESSRQSLPSLKDSCQRELTNLLG
LHPKIEMARASCSALMSQPSAPDFVQRGFDSFLGRYQAVQEAVEDRQQHL
ENELKGQPGHAYLETLKTLKDVLNDSENKAQVSLNVLNDLAKVEKALQEK
KTLDEILENQKPALHKLAEETKALEKNVHPDVEKLYKQEFDDVQGKWNKL
KVLVSKDLHLLEEIALTLRAFEADSTVIEKWMDGVKDFLMKQQAAQGDDA
GLQRQLDQCSAFVNEIETIESSLKNMKEIETNLRSGPVAGIKTWVQTRLG
DYQTQLEKLSKEIATQKSRLSESQEKAANLKKDLAEMQEWMTQAEEEYLE
RDFEYKSPEELESAVEEMKRAKEDVLQKEVRVKILKDNIKLLAAKVPSGG
QELTSELNVVLENYQLLCNRIRGKCHTLEEVWSCWIELLHYLDLETTWLN
TLEERMKSTEVLPEKTDAVNEALESLESVLRHPADNRTQIRELGQTLIDG
GILDDIISEKLEAFNSRYEDLSHLAESKQISLEKQLQVLRETDQMLQVLQ
ESLGELDKQLTTYLTDRIDAFQVPQEAQKIQAEISAHELTLEELRRNMRS
QPLTSPESRTARGGSQMDVLQRKLREVSTKFQLFQKPANFEQRMLDCKRV
LDGVKAELHVLDVKDVDPDVIQTHLDKCMKLYKTLSEVKLEVETVIKTGR
HIVQKQQTDNPKGMDEQLTSLKVLYNDLGAQVTEGKQDLERASQLARKMK
KEAASLSEWLSATETELVQKSTSEGLLGDLDTEISWAKNVLKDLEKRKAD
LNTITESSAALQNLIEGSEPILEERLCVLNAGWSRVRTWTEDWCNTLMNH
QNQLEIFDGNVAHISTWLYQAEALLDEIEKKPTSKQEEIVKRLVSELDDA
NLQVENVRDQALILMNARGSSSRELVEPKLAELNRNFEKVSQHIKSAKLL
IAQEPLYQCLVTTETFETGVPFSDLEKLENDIENMLKFVEKHLESSDEDE
KMDEESAQIEEVLQRGEEMLHQPMEDNKKEKIRLQLLLLHTRYNKIKAIP
IQQRKMGQLASGIRSSLLPTDYLVEINKILLCMDDVELSLNVPELNTAIY
EDFSFQEDSLKNIKDQLDKLGEQIAVIHEKQPDVILEASGPEAIQIRDTL
TQLNAKWDRINRMYSDRKGCFDRAMEEWRQFHCDLNDLTQWITEAEELLV
DTCAPGGSLDLEKARIHQQELEVGISSHQPSFAALNRTGDGIVQKLSQAD
GSFLKEKLAGLNQRWDAIVAEVKDRQPRLKGESKQVMKYRHQLDEIICWL
TKAEHAMQKRSTTELGENLQELRDLTQEMEVHAEKLKWLNRTELEMLSDK
SLSLPERDKISESLRTVNMTWNKICREVPTTLKECIQEPSSVSQTRIAAH
PNVQKVVLVSSASDIPVQSHRTSEISIPADLDKTITELADWLVLIDQMLK
SNIVTVGDVEEINKTVSRMKITKADLEQRHPQLDYVFTLAQNLKNKASSS
DMRTAITEKLERVKNQWDGTQHGVELRQQQLEDMIIDSLQWDDHREETEE
LMRKYEARLYILQQARRDPLTKQISDNQILLQELGPGDGIVMAFDNVLQK
LLEEYGSDDTRNVKETTEYLKTSWINLKQSIADRQNALEAEWRTVQASRR
DLENFLKWIQEAETTVNVLVDASHRENALQDSILARELKQQMQDIQAEID
AHNDIFKSIDGNRQKMVKALGNSEEATMLQHRLDDMNQRWNDLKAKSASI
RAHLEASAEKWNRLLMSLEELIKWLNMKDEELKKQMPIGGDVPALQLQYD
HCKALRRELKEKEYSVLNAVDQARVFLADQPIEAPEEPRRNLQSKTELTP
EERAQKIAKAMRKQSSEVKEKWESLNAVTSNWQKQVDKALEKLRDLQGAM
DDLDADMKEAESVRNGWKPVGDLLIDSLQDHIEKIMAFREEIAPINFKVK
TVNDLSSQLSPLDLHPSLKMSRQLDDLNMRWKLLQVSVDDRLKQLQEAHR
DFGPSSQHFLSTSVQLPWQRSISHNKVPYYINHQTQTTCWDHPKMTELFQ
SLADLNNVRFSAYRTAIKIRRLQKALCLDLLELSTTNEIFKQHKLNQNDQ
LLSVPDVINCLTTTYDGLEQMHKDLVNVPLCVDMCLNWLLNVYDTGRTGK
IRVQSLKIGLMSLSKGLLEEKYRYLFKEVAGPTEMCDQRQLGLLLHDAIQ
IPRQLGEVAAFGGSNIEPSVRSCFQQNNNKPEISVKEFIDWMHLEPQSMV
WLPVLHRVAAAETAKHQAKCNICKECPIVGFRYRSLKHFNYDVCQSCFFS
GRTAKGHKLHYPMVEYCIPTTSGEDVRDFTKVLKNKFRSKKYFAKHPRLG
YLPVQTVLEGDNLETPITLISMWPEHYDPSQSPQLFHDDTHSRIEQYATR
LAQMERTNGSFLTDSSSTTGSVEDEHALIQQYCQTLGGESPVSQPQSPAQ
ILKSVEREERGELERIIADLEEEQRNLQVEYEQLKDQHLRRGLPVGSPPE
SIISPHHTSEDSELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLR
QLLEQPESDSRINGVSPWASPQHSALSYSLDPDASGPQFHQAAGEDLLAP
PHDTSTDLTEVMEQIHSTFPSCCPNVPSRPQAM

Кодований геном білок за функцією належить до фосфопротеїнів. Білок має сайт для зв'язування з молекулою актину, іонами металів, іоном цинку, іоном кальцію. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані, клітинних контактах, синапсах.

Література[ред. | ред. код]

  • Wilson J., Putt W., Jimenez C., Edwards Y.H. (1999). Up71 and up140, two novel transcripts of utrophin that are homologues of short forms of dystrophin.. Hum. Mol. Genet. 8: 1271 — 1278.  PubMed DOI:10.1093/hmg/8.7.1271
  • Burton E.A., Tinsley J.M., Holzfeind P.J., Rodrigues N.R., Davies K.E. (1999). A second promoter provides an alternative target for therapeutic up-regulation of utrophin in Duchenne muscular dystrophy.. Proc. Natl. Acad. Sci. U.S.A. 96: 14025 — 14030.  PubMed DOI:10.1073/pnas.96.24.14025
  • Ahn A.H., Kunkel L.M. (1995). Syntrophin binds to an alternatively spliced exon of dystrophin.. J. Cell Biol. 128: 363 — 371.  PubMed DOI:10.1083/jcb.128.3.363
  • Tommasi di Vignano A., Di Zenzo G., Sudol M., Cesareni G., Dente L. (2000). Contribution of the different modules in the utrophin carboxy-terminal region to the formation and regulation of the DAP complex.. FEBS Lett. 471: 229 — 234.  PubMed DOI:10.1016/S0014-5793(00)01400-9
  • Bhosle R.C., Michele D.E., Campbell K.P., Li Z., Robson R.M. (2006). Interactions of intermediate filament protein synemin with dystrophin and utrophin.. Biochem. Biophys. Res. Commun. 346: 768 — 777.  PubMed DOI:10.1016/j.bbrc.2006.05.192
  • Singh S.M., Bandi S., Winder S.J., Mallela K.M. (2014). The actin binding affinity of the utrophin tandem calponin-homology domain is primarily determined by its N-terminal domain.. Biochemistry 53: 1801 — 1809.  PubMed DOI:10.1021/bi500149q

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:12635 (англ.). Процитовано 6 вересня 2017. 
  2. UniProt, P46939 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]