UXT

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
UXT
Ідентифікатори
Символи UXT, ART-27, STAP1, ubiquitously expressed prefoldin like chaperone
Зовнішні ІД OMIM: 300234 MGI: 1277988 HomoloGene: 40902 GeneCards: UXT
Шаблон експресії
PBB GE UXT 218495 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004182
NM_153477
NM_013840
RefSeq (білок)
NP_004173
NP_705582
NP_038868
NP_038868
Локус (UCSC) Хр. X: 47.65 – 47.66 Mb Хр. X: 20.94 – 20.96 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

UXT (англ. Ubiquitously expressed prefoldin like chaperone) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[3] Довжина поліпептидного ланцюга білка становить 157 амінокислот, а молекулярна маса — 18 246[4].

Послідовність амінокислот
1020304050
MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL
QLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLE
LTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQN
FPEKPHH

Кодований геном білок за функціями належить до шаперонів, репресорів, активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Локалізований у цитоплазмі, цитоскелеті, ядрі.

Література[ред. | ред. код]

  • Schroer A., Schneider S., Ropers H.-H., Nothwang H.G. (1999). Cloning and characterization of UXT, a novel gene in human Xp11, which is widely and abundantly expressed in tumor tissue.. Genomics 56: 340 — 343.  PubMed DOI:10.1006/geno.1998.5712
  • McGilvray R., Walker M., Bartholomew C. (2007). UXT interacts with the transcriptional repressor protein EVI1 and suppresses cell transformation.. FEBS J. 274: 3960 — 3971.  PubMed DOI:10.1111/j.1742-4658.2007.05928.x
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Liu L., McKeehan W.L. (2002). Sequence analysis of LRPPRC and its SEC1 domain interaction partners suggests roles in cytoskeletal organization, vesicular trafficking, nucleocytosolic shuttling, and chromosome activity.. Genomics 79: 124 — 136.  PubMed DOI:10.1006/geno.2001.6679
  • Moss T.N., Vo A., McKeehan W.L., Liu L. (2007). UXT (Ubiquitously Expressed Transcript) causes mitochondrial aggregation.. In Vitro Cell. Dev. Biol. Anim. 43: 139 — 146.  PubMed DOI:10.1007/s11626-007-9016-6

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:12641 (англ.). Процитовано 13 вересня 2017. 
  4. UniProt, Q9UBK9 (англ.). Процитовано 13 вересня 2017. 

Див. також[ред. | ред. код]