VHL

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
VHL
Ідентифікатори
Символи pVHLvon Hippel-Lindau tumor suppressorE3 ubiquitin protein ligaseVHLvon Hippel-Lindau disease tumor suppressorprotein G7elongin binding protein
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE VHL 203844 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

VHL (англ. Von Hippel-Lindau tumor suppressor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 213 амінокислот, а молекулярна маса — 24 153[2].

Послідовність амінокислот
1020304050
MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGA
EEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPT
LPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFAN
ITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLER
LTQERIAHQRMGD

Задіяний у таких біологічних процесах як убіквітинування білків, поліморфізм, альтернативний сплайсинг. Локалізований у цитоплазмі, ядрі, мембрані.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Richards F.M., Schofield P.N., Fleming S., Maher E.R. (1996). Expression of the von Hippel-Lindau disease tumour suppressor gene during human embryogenesis.. Hum. Mol. Genet. 5: 639 — 644.  PubMed DOI:10.1093/hmg/5.5.639
  • Schoenfeld A., Davidowitz E.J., Burk R.D. (1998). A second major native von Hippel-Lindau gene product, initiated from an internal translation start site, functions as a tumor suppressor.. Proc. Natl. Acad. Sci. U.S.A. 95: 8817 — 8822.  PubMed DOI:10.1073/pnas.95.15.8817
  • Kibel A., Iliopoulos O., DeCaprio J.A., Kaelin W.G. Jr. (1995). Binding of the von Hippel-Lindau tumor suppressor protein to Elongin B and C.. Science 269: 1444 — 1446.  PubMed DOI:10.1126/science.7660130
  • Iliopoulos O., Ohh M., Kaelin W.G. Jr. (1998). pVHL19 is a biologically active product of the von Hippel-Lindau gene arising from internal translation initiation.. Proc. Natl. Acad. Sci. U.S.A. 95: 11661 — 11666.  PubMed DOI:10.1073/pnas.95.20.11661
  • Feldman D.E., Thulasiraman V., Ferreyra R.G., Frydman J. (1999). Formation of the VHL-elongin BC tumor suppressor complex is mediated by the chaperonin TRiC.. Mol. Cell 4: 1051 — 1061.  PubMed DOI:10.1016/S1097-2765(00)80233-6

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:12687 (англ.). Процитовано 30 серпня 2017. 
  2. UniProt, P40337 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]