ZBTB16

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZBTB16
Protein ZBTB16 PDB 1buo.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ZBTB16, PLZF, ZNF145, zinc finger and BTB domain containing 16
Зовнішні ІД OMIM: 176797 MGI: 103222 HomoloGene: 21214 GeneCards: ZBTB16
Пов'язані генетичні захворювання
conduct disorder[1]
Шаблон експресії
PBB GE ZBTB16 205883 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001018011
NM_006006
NM_001354750
NM_001354751
NM_001354752
NM_001033324
NM_001364543
RefSeq (білок)
NP_001018011
NP_005997
NP_001341679
NP_001341680
NP_001341681
NP_001028496
NP_001351472
Локус (UCSC) Хр. 11: 114.06 – 114.26 Mb Хр. 9: 48.65 – 48.84 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZBTB16 (англ. Zinc finger and BTB domain containing 16) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 673 амінокислот, а молекулярна маса — 74 274[5].

Послідовність амінокислот
1020304050
MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRT
VLACTSKMFEILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLD
DLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADGGAEEEEDRKA
RYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSAMSPTK
AAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAEVKTEMMQVDE
VPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE
ESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPS
SVTSGLHVQPALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESR
TIGEQCSVCGVELPDNEAVEQHRKLHSGMKTYGCELCGKRFLDSLRLRMH
LLAHSAGAKAFVCDQCGAQFSKEDALETHRQTHTGTDMAVFCLLCGKRFQ
AQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSHTGDHPYECEF
CGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK
PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMK
GHKPEEIPPDWRIEKTYLYLCYV

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, убіквітинування білків, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Furukawa M., He Y.J., Borchers C., Xiong Y. (2003). Targeting of protein ubiquitination by BTB-Cullin 3-Roc1 ubiquitin ligases.. Nat. Cell Biol. 5: 1001 — 1007.  PubMed DOI:10.1038/ncb1056
  • Ahmad K.F., Engel C.K., Prive G.G. (1998). Crystal structure of the BTB domain from PLZF.. Proc. Natl. Acad. Sci. U.S.A. 95: 12123 — 12128.  PubMed DOI:10.1073/pnas.95.21.12123

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]