ZNF384

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF384
Ідентифікатори
Символи ZNF384, CAGH1, CAGH1A, CIZ, ERDA2, NMP4, NP, TNRC1, zinc finger protein 384
Зовнішні ІД OMIM: 609951 MGI: 2443203 HomoloGene: 15849 GeneCards: ZNF384
Шаблон експресії
PBB GE ZNF384 212369 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
NP_001035009
NP_001129206
NP_597733
н/д
Локус (UCSC) Хр. 12: 6.67 – 6.69 Mb Хр. 6: 125.01 – 125.04 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF384 (англ. Zinc finger protein 384) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 577 амінокислот, а молекулярна маса — 63 219[4].

Послідовність амінокислот
1020304050
MEESHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYP
TLLTVPASVSLPSGISMDTESKSDQLTPHSQASVTQNITVVPVPSTGLMT
AGVSCSQRWRREGSQSRGPGLVITSPSGSLVTTASSAQTFPISAPMIVSA
LPPGSQALQVVPDLSKKVASTLTEEGGGGGGGGGSVAPKPPRGRKKKRML
ESGLPEMNDPYVLSPEDDDDHQKDGKTYRCRMCSLTFYSKSEMQIHSKSH
TETKPHKCPHCSKTFANSSYLAQHIRIHSGAKPYSCNFCEKSFRQLSHLQ
QHTRIHSKMHTETIKPHKCPHCSKTFANTSYLAQHLRIHSGAKPYNCSYC
QKAFRQLSHLQQHTRIHTGDRPYKCAHPGCEKAFTQLSNLQSHRRQHNKD
KPFKCHNCHRAYTDAASLEVHLSTHTVKHAKVYTCTICSRAYTSETYLMK
HMRKHNPPDLQQQVQAAAAAAAVAQAQAQAQAQAQAQAQAQAQAQASQAS
QQQQQQQQQQQQQQQQPPPHFQSPGAAPQGGGGGDSNPNPPPQCSFDLTP
YKTAEHHKDICLTVTTSTIQVEHLASS

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11955 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q8TF68 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]