ZNF41

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF41
Ідентифікатори
Символи ZNF41, MRX89, zinc finger protein 41
Зовнішні ІД OMIM: 314995 HomoloGene: 133263 GeneCards: ZNF41
Шаблон експресії
PBB GE ZNF41 214904 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
RefSeq (білок)
н/д
Локус (UCSC) Хр. X: 47.45 – 47.48 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

ZNF41 (англ. Zinc finger protein 41) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[2] Довжина поліпептидного ланцюга білка становить 821 амінокислот, а молекулярна маса — 93 728[3].

Послідовність амінокислот
1020304050
MAANGDSPPWSPALAAEGRGSSCEVRRERTPEARIHSVKRYPDLSPGPKG
RSSADHAALNSIVSLQASVSFEDVTVDFSKEEWQHLDPAQRRLYWDVTLE
NYSHLLSVGYQIPKSEAAFKLEQGEGPWMLEGEAPHQSCSGEAIGKMQQQ
GIPGGIFFHCERFDQPIGEDSLCSILEELWQDNDQLEQRQENQNNLLSHV
KVLIKERGYEHKNIEKIIHVTTKLVPSIKRLHNCDTILKHTLNSHNHNRN
SATKNLGKIFGNGNNFPHSPSSTKNENAKTGANSCEHDHYEKHLSHKQAP
THHQKIHPEEKLYVCTECVMGFTQKSHLFEHQRIHAGEKSRECDKSNKVF
PQKPQVDVHPSVYTGEKPYLCTQCGKVFTLKSNLITHQKIHTGQKPYKCS
ECGKAFFQRSDLFRHLRIHTGEKPYECSECGKGFSQNSDLSIHQKTHTGE
KHYECNECGKAFTRKSALRMHQRIHTGEKPYVCADCGKAFIQKSHFNTHQ
RIHTGEKPYECSDCGKSFTKKSQLHVHQRIHTGEKPYICTECGKVFTHRT
NLTTHQKTHTGEKPYMCAECGKAFTDQSNLIKHQKTHTGEKPYKCNGCGK
AFIWKSRLKIHQKSHIGERHYECKDCGKAFIQKSTLSVHQRIHTGEKPYV
CPECGKAFIQKSHFIAHHRIHTGEKPYECSDCGKCFTKKSQLRVHQKIHT
GEKPNICAECGKAFTDRSNLITHQKIHTREKPYECGDCGKTFTWKSRLNI
HQKSHTGERHYECSKCGKAFIQKATLSMHQIIHTGKKPYACTECQKAFTD
RSNLIKHQKMHSGEKRYKASD

Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Franze A., Archidiacono N., Rocchi M., Marino M., Grimaldi G. (1991). Isolation and expression analysis of a human zinc finger gene (ZNF41) located on the short arm of the X chromosome.. Genomics 9: 728 — 736.  PubMed DOI:10.1016/0888-7543(91)90367-N
  • Piton A., Redin C., Mandel J.L. (2013). XLID-causing mutations and associated genes challenged in light of data from large-scale human exome sequencing.. Am. J. Hum. Genet. 93: 368 — 383.  PubMed DOI:10.1016/j.ajhg.2013.06.013
  • Rosati M., Franze A., Matarazzo M.R., Grimaldi G. (1999). Coding region intron/exon organization, alternative splicing and X-chromosome inactivation of the KRAB/FPB-domain-containing human zinc finger gene ZNF41.. Cytogenet. Cell Genet. 85: 291 — 296.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:13107 (англ.). Процитовано 13 вересня 2017. 
  3. UniProt, P51814 (англ.). Процитовано 13 вересня 2017. 

Див. також[ред. | ред. код]