ZNF644

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF644
Ідентифікатори
Символи ZNF644, BM-005, MYP21, NatF, ZEP-2, zinc finger protein 644
Зовнішні ІД OMIM: 614159 MGI: 1277212 HomoloGene: 12971 GeneCards: ZNF644
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_016620
NM_032186
NM_201269
RefSeq (білок)
NP_057704
NP_115562
NP_958357
н/д
Локус (UCSC) Хр. 1: 90.92 – 91.02 Mb Хр. 5: 106.62 – 106.7 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF644 (англ. Zinc finger protein 644) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 1 327 амінокислот, а молекулярна маса — 149 565[4].

Послідовність амінокислот
1020304050
MRSFLQQDVNKTKSRLNVLNGLANNMDDLKINTDITGAKEELLDDNNFIS
DKESGVHKPKDCQTSFQKNNTLTLPEELSKDKSENALSGGQSSLFIHAGA
PTVSSENFILPKGAAVNGPVSHSSLTKTSNMNKGSVSLTTGQPVDQPTTE
SCSTLKVAADLQLSTPQKASQHQVLFLLSDVAHAKNPTHSNKKLPTSASV
GCDIQNSVGSNIKSDGTLINQVEVGEDGEDLLVKDDCVNTVTGISSGTDG
FRSENDTNWDPQKEFIQFLMTNEETVDKAPPHSKIGLEKKRKRKMDVSKI
TRYTEDCFSDSNCVPNKSKMQEVDFLEQNEELQAVDSQKYALSKVKPEST
DEDLESVDAFQHLIYNPDKCGEESSPVHTSTFLSNTLKKKCEESDSESPA
TFSTEEPSFYPCTKCNVNFREKKHLHRHMMYHLDGNSHFRHLNVPRPYAC
RECGRTFRDRNSLLKHMIIHQERRQKLMEEIRELKELQDEGRSARLQCPQ
CVFGTNCPKTFVQHAKTHEKDKRYYCCEECNFMAVTENELECHRGIAHGA
VVKCPMVTSDIAQRKTQKKTFMKDSVVGSSKKSATYICKMCPFTTSAKSV
LKKHTEYLHSSSCVDSFGSPLGLDKRKNDILEEPVDSDSTKTLTKQQSTT
FPKNSALKQDVKRTFGSTSQSSSFSKIHKRPHRIQKARKSIAQSGVNMCN
QNSSPHKNVTIKSSVDQKPKYFHQAAKEKSNAKANSHYLYRHKYENYRMI
KKSGESYPVHFKKEEASSLNSLHLFSSSSNSHNNFISDPHKPDAKRPESF
KDHRRVAVKRVIKESKKESSVGGEDLDSYPDFLHKMTVVVLQKLNSAEKK
DSYETEDESSWDNVELGDYTTQAIEDETYSDINQEHVNLFPLFKSKVEGQ
EPGENATLSYDQNDGFYFEYYEDTGSNNFLHEIHDPQHLETADASLSKHS
SVFHWTDLSLEKKSCPYCPATFETGVGLSNHVRGHLHRAGLSYEARHVVS
PEQIATSDKMQHFKRTGTGTPVKRVRKAIEKSETTSEHTCQLCGGWFDTK
IGLSNHVRGHLKRLGKTKWDAHKSPICVLNEMMQNEEKYEKILKALNSRR
IIPRPFVAQKLASSDDFISQNVIPLEAYRNGLKTEALSVSASEEEGLNFL
NEYDETKPELPSGKKNQSLTLIELLKNKRMGEERNSAISPQKIHNQTARK
RFVQKCVLPLNEDSPLMYQPQKMDLTMHSALDCKQKKSRSRSGSKKKMLT
LPHGADEVYILRCRFCGLVFRGPLSVQEDWIKHLQRHIVNANLPRTGAGM
VEVTSLLKKPASITETSFSLLMAEAAS

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Impens F., Radoshevich L., Cossart P., Ribet D. (2014). Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.. Proc. Natl. Acad. Sci. U.S.A. 111: 12432 — 12437.  PubMed DOI:10.1073/pnas.1413825111
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:29222 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, Q9H582 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]