TOMM22

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TOMM22
Ідентифікатори
Символи TOMM22, 1C9-2, MST065, MSTP065, TOM22, translocase of outer mitochondrial membrane 22
Зовнішні ІД OMIM: 607046 MGI: 2450248 HomoloGene: 10638 GeneCards: TOMM22
Шаблон експресії
PBB GE TOMM22 217960 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_020243
NM_172609
RefSeq (білок)
NP_064628
NP_766197
Локус (UCSC) Хр. 22: 38.68 – 38.69 Mb Хр. 15: 79.67 – 79.67 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TOMM22 (англ. Translocase of outer mitochondrial membrane 22) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 22-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 142 амінокислот, а молекулярна маса — 15 522[4].

Послідовність амінокислот
1020304050
MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWG
LTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVV
FETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI

Кодований геном білок за функціями належить до рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт, транспорт білків, транслокація, ацетилювання. Локалізований у мембрані, мітохондрії, зовнішній мембрані мітохондрій.

Література[ред. | ред. код]

  • Yano M., Hoogenraad N., Terada K., Mori M. (2000). Identification and functional analysis of human Tom22 for protein import into mitochondria.. Mol. Cell. Biol. 20: 7205 — 7213.  PubMed DOI:10.1128/MCB.20.19.7205-7213.2000
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kato H., Mihara K. (2008). Identification of Tom5 and Tom6 in the preprotein translocase complex of human mitochondrial outer membrane.. Biochem. Biophys. Res. Commun. 369: 958 — 963.  PubMed DOI:10.1016/j.bbrc.2008.02.150

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:18002 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q9NS69 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]