Глюкозофосфатізомераза

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Глюкозофосфатізомераза
Protein GPI PDB 1dqr.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GPI, AMF, GNPI, NLK, PGI, PHI, SA-36, SA36, glucose-6-phosphate isomerase
Зовнішні ІД OMIM: 172400 MGI: 95797 HomoloGene: 145 GeneCards: GPI
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_008155
RefSeq (білок)
NP_032181
Локус (UCSC) Хр. 19: 34.36 – 34.4 Mb Хр. 7: 34.2 – 34.23 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Глюкозофосфатізомераза (англ. Glucose-6-phosphate isomerase) – білок, який кодується геном GPI, розташованим у людей на короткому плечі 19-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 558 амінокислот, а молекулярна маса — 63 147[4].

Послідовність амінокислот
1020304050
MAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGH
ILVDYSKNLVTEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLH
VALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTIT
DVINIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLN
PESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALSTNT
TKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGA
HWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAA
YFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTK
MIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQ
AAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAMYEHKIFV
QGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIK
QQREARVQ

Цей білок за функціями належить до ізомераз, цитокінів, факторів росту. Задіяний у таких біологічних процесах як гліколіз, глюконеогенез, ангіогенез. Локалізований у цитоплазмі. Також секретований назовні.

Література[ред. | ред. код]

  • Yakirevich E., Naot Y. (2000). Cloning of a glucose phosphate isomerase/neuroleukin-like sperm antigen involved in sperm agglutination.. Biol. Reprod. 62: 1016 — 1023.  PubMed DOI:10.1095/biolreprod62.4.1016
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Walker J.I.H., Faik P., Morgan M.J. (1990). Characterization of the 5' end of the gene for human glucose phosphate isomerase (GPI).. Genomics 7: 638 — 643.  PubMed DOI:10.1016/0888-7543(90)90212-D
  • Faik P., Walker J.I.H., Redmill A.A.M., Morgan M.J. (1988). Mouse glucose-6-phosphate isomerase and neuroleukin have identical 3' sequences.. Nature 332: 455 — 456.  PubMed DOI:10.1038/332455a0
  • Haga A., Niinaka Y., Raz A. (2000). Phosphohexose isomerase/autocrine motility factor/neuroleukin/maturation factor is a multifunctional phosphoprotein.. Biochim. Biophys. Acta 1480: 235 — 244.  PubMed DOI:10.1016/S0167-4838(00)00075-3
  • Funasaka T., Haga A., Raz A., Nagase H. (2001). Tumor autocrine motility factor is an angiogenic factor that stimulates endothelial cell motility.. Biochem. Biophys. Res. Commun. 285: 118 — 128.  PubMed DOI:10.1006/bbrc.2001.5135

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4458 (англ.). Процитовано 30 січня 2017. 
  4. UniProt, P06744 (англ.). Процитовано 30 січня 2017. 

Див. також[ред. | ред. код]