Циклофилін B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Циклофилін B
Protein PPIB PDB 1cyn.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PPIB, CYP-S1, CYPB, HEL-S-39, OI9, SCYLP, peptidylprolyl isomerase B, B
Зовнішні ІД OMIM: 123841 MGI: 97750 HomoloGene: 726 GeneCards: PPIB
Пов'язані генетичні захворювання
osteogenesis imperfecta type 9[1]
Шаблон експресії
PBB GE PPIB 200968 s at fs.png

PBB GE PPIB 200967 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000942
NM_011149
RefSeq (білок)
NP_000933
NP_035279
Локус (UCSC) Хр. 15: 64.16 – 64.16 Mb Хр. 9: 66.06 – 66.07 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Циклофилін B (англ. Peptidylprolyl isomerase B) – білок, який кодується геном PPIB, розташованим у людей на короткому плечі 15-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 216 амінокислот, а молекулярна маса — 23 743[5].

Послідовність амінокислот
1020304050
MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDL
RIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDF
MIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGS
QFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIA
DCGKIEVEKPFAIAKE

Цей білок за функціями належить до ізомераз, ротамаз. Локалізований у ендоплазматичному ретикулумі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hasel K.W., Glass J.R., Godbout M., Sutcliffe J.G. (1991). An endoplasmic reticulum-specific cyclophilin.. Mol. Cell. Biol. 11: 3484 — 3491.  PubMed DOI:10.1128/MCB.11.7.3484
  • Arber S., Krause K.-H., Caroni P. (1992). S-cyclophilin is retained intracellularly via a unique COOH-terminal sequence and colocalizes with the calcium storage protein calreticulin.. J. Cell Biol. 116: 113 — 125.  PubMed DOI:10.1083/jcb.116.1.113
  • Mikol V., Kallen J., Walkinshaw M.D. (1994). X-ray structure of a cyclophilin B/cyclosporin complex: comparison with cyclophilin A and delineation of its calcineurin-binding domain.. Proc. Natl. Acad. Sci. U.S.A. 91: 5183 — 5186.  PubMed DOI:10.1073/pnas.91.11.5183

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]